Clone RH04493 Report

Search the DGRC for RH04493

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:44
Well:93
Vector:pFlc-1
Associated Gene/TranscriptRpS11-RB
Protein status:RH04493.pep: gold
Sequenced Size:588

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpS11 2009-04-06 Manual selection by Sue Celniker

Clone Sequence Records

RH04493.complete Sequence

588 bp assembled on 2009-05-29

GenBank Submission: BT088762.1

> RH04493.complete
GTTTGCCTTTTTCATCAACATGGCTGATCAGCAAACCGAACGCTCGTTCC
GCAAGCAACACGCGGTGGTCGTTGTGCGTCGCAAGAGCCCCAACTTGAAG
AAAAGGCCCCGTTTCTATCGCCAAATTGGCCTGGGCTTCCGCGCTCCGGC
GGAGGCCATCGATGGTACCTACATCGACAAGAAGTGCCCCTGGACCGGTG
ATGTGAGGATCCGTGGTCGCATTCTGACCGGCGTGGTCCGCAAGGCCAAG
ATGCAGCGCACCATTGTCATTCGGCGCGACTACCTGCACTTTGTGCGCAA
ATACAGCCGTTTCGAGAAGCGTCACCGCAACATGAGCGTCCACTGCTCCC
CTGTGTTCAGAGATGTTGAGCATGGCGATATTGTCACCATTGGTGAGTGC
CGTCCTCTGTCCAAGACTGTGCGCTTCAACGTCCTGAAAGTCAGCAAGGG
TCAGGGAGCCAAGAAGAGCTTCAAGAAGTACTAGAGCGGACAACTACCAT
TCGGGCGATAATATTTGTAGCAATTATTCTTTTTGAATAAAACAAAAAAA
AGTAACTTTAAAAAAAAAAAAGAAAAAAAAAAAAAAAA

RH04493.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RB 768 RpS11-RB 44..599 6..561 2780 100 Plus
RpS11.a 897 RpS11.a 319..728 152..561 2050 100 Plus
RpS11-RC 894 RpS11-RC 315..724 152..561 2050 100 Plus
RpS11.a 897 RpS11.a 47..195 6..154 745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8087050..8087257 360..153 1040 100 Minus
chr2R 21145070 chr2R 8086605..8086808 561..358 1020 100 Minus
chr2R 21145070 chr2R 8087643..8087769 155..29 635 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RB 465 CG8857-PB 1..465 20..484 2325 100 Plus
RpS11-RC 468 CG8857-PC 136..468 152..484 1665 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RB 569 CG8857-RB 16..569 6..559 2770 100 Plus
RpS11-RC 738 CG8857-RC 165..574 152..561 2050 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PB 154 CG8857-PB 1..154 20..481 807 100 Plus
RpS11-PC 155 CG8857-PC 1..155 20..481 660 83.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12199834..12200041 360..153 1040 100 Minus
2R 25286936 2R 12199389..12199592 561..358 1020 100 Minus
2R 25286936 2R 12200427..12200553 155..29 635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12201033..12201240 360..153 1040 100 Minus
2R 25260384 2R 12200588..12200791 561..358 1020 100 Minus
2R 25260384 2R 12201626..12201752 155..29 635 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:50:07 has no hits.

RH04493.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:17:33 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8087991..8088019 1..31 93   Minus
chr2R 8087644..8087766 32..154 100 <- Minus
chr2R 8087050..8087255 155..360 100 <- Minus
chr2R 8086607..8086805 361..559 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:52 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 1..465 20..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:41 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 1..465 20..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:00 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 1..465 20..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:17:33 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 1..465 20..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-29 16:12:13 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 25..582 1..559 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:41 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 25..582 1..559 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:00 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 12..569 1..559 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:17:33 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 12..569 1..559 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:17:33 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12200775..12200803 1..31 93   Minus
2R 12200428..12200550 32..154 100 <- Minus
2R 12199834..12200039 155..360 100 <- Minus
2R 12199391..12199589 361..559 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:00 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8088280..8088308 1..31 93   Minus
arm_2R 8087933..8088055 32..154 100 <- Minus
arm_2R 8087339..8087544 155..360 100 <- Minus
arm_2R 8086896..8087094 361..559 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:03 Download gff for RH04493.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12201974..12202002 1..31 93   Minus
2R 12201627..12201749 32..154 100 <- Minus
2R 12201033..12201238 155..360 100 <- Minus
2R 12200590..12200788 361..559 100 <- Minus

RH04493.pep Sequence

Translation from 1 to 483

> RH04493.pep
FAFFINMADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPA
EAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRK
YSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKG
QGAKKSFKKY*

RH04493.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12077-PA 196 GF12077-PA 1..196 7..160 740 76.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22596-PA 196 GG22596-PA 1..196 7..160 756 78.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22980-PA 196 GH22980-PA 1..196 7..160 665 69.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PB 154 CG8857-PB 1..154 7..160 807 100 Plus
RpS11-PC 155 CG8857-PC 1..155 7..160 660 83.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18949-PA 196 GI18949-PA 1..196 7..160 693 71.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11264-PA 196 GL11264-PA 1..196 7..160 712 73.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21371-PA 196 GA21371-PA 1..196 7..160 712 73.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20375-PA 196 GM20375-PA 1..196 7..160 748 77.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15239-PA 196 GD15239-PA 1..196 7..160 754 78.1 Plus
Dsim\GD25853-PA 115 GD25853-PA 6..115 51..160 577 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21555-PA 196 GJ21555-PA 1..196 7..160 686 71.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22117-PA 196 GK22117-PA 1..196 7..160 703 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13464-PA 196 GE13464-PA 1..196 7..160 756 78.6 Plus

RH04493.hyp Sequence

Translation from 3 to 483

> RH04493.hyp
SFFINMADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAE
AIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKY
SRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKGQ
GAKKSFKKY*

RH04493.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PB 154 CG8857-PB 1..154 6..159 807 100 Plus
RpS11-PC 155 CG8857-PC 1..155 6..159 660 83.3 Plus