Clone RH04670 Report

Search the DGRC for RH04670

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:46
Well:70
Vector:pFlc-1
Associated Gene/TranscriptCG5196-RA
Protein status:RH04670.pep: gold
Sequenced Size:1727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5196-RA 2008-10-27 Manual selection by Ken Wan

Clone Sequence Records

RH04670.complete Sequence

1727 bp assembled on 2009-04-13

GenBank Submission: BT082042.1

> RH04670.complete
GTTCGATACCGCTGTTGGCTGCCTTCGTTGTTTACCTTTTGGTCATTAGC
AATTTCGACGCCAACGCGAGAATACACAGATTATGAGTCCTGAAATATCC
GGCTTCCGGCGGTTCCTGCATTGGGGCCCCATTACCGCCCTTAGCATCAT
CAAGTGCATAACGCTGACAACGCTCTATATGAACTCGATGTGGTGGCCGC
CAAATAAATCATTCGCCGGATTCGCCCACCAGGCCCTCTTCCTGCTCCTT
TCCACGCTGGCCACATTCAATTACGTCATGGCCACTTTGACTGGTCCCGG
ACTGATGCCAAAACAGTGGCATCCCAAGGATCCCAAGGACGCCCAGTTCC
TGCAGTACTGCAAAAAGTGCGAGGGCTACAAGGCACCACGCTCCCATCAT
TGTCGCAAGTGTGATCGCTGCGTCAAGAAGATGGACCATCACTGCCCATG
GATCAATCACTGCGTTGGCTGGGCCAACCACGCGTACTTCACATACTTCC
TGCTCTTCTCCATCCTGGGCAGCCTGCAGGGCACCGTGGTGCTATGCTGC
TCCTTCTGGCGGGGAATCTACCGCTACTACTATCTCACCCACGGATTGGC
GCACTTGGCTAGCGTGCAGTTCACTCTGCTCAGCATCATCATGTGCATTC
TGGGCATGGGCCTGGCCATCGGTGTCGTCATTGGCCTGAGCATGCTGCTG
TTCATTCAGCTGAAGACGATTGTAAACAACCAGACGGGCATAGAGATCTG
GATAGTGGAGAAGGCCATTTACCGCCGATATAGGAATGCCGACTGCGACG
ACGAGTTCCTATATCCCTATGATTTGGGCTGGCGGGCAAATTTGCGACTG
GTATTCAATGACGAGTGCCAAAAGCGAGGCGATGGCATCGAGTGGCCAGT
GGTGGAGGGTTGTGATCAGTATACATTGACGCGCGAGCAACTGGCGCAGA
AGGAGGAGAAACGAGCTCGAACCCGCACCTTCAAATGCACAAGGCCAGTG
ACTGGCCGTTGGCTGCCGATCTTTTCGCAGGGTTGGCGTGTTTGTGTGGC
CGCTCCCTGCTCCGATGAGCCACGCATCAGCCTGCGACCCAACGACATGA
TTAAGGTCACTCGCTTCCGCAACCACTGGCTGTTCGGCGAGCGAGTGCTT
TCCGAGCAAGAGCTAGCTGGCGTCAAGAAGCGCCAACGCAAGGGTCCCAT
TCGTGGCTGGTTCCCACGACGCAGCGCCGTTGAGGTCATTGAGGCGGTCC
ATGAAGGCAGCGGCGATGGCAACAGCGAGACACCAGCACCTGCGGCCCAG
AATGGCAACGCCCACAGCCACTTGAAGCAGCAGCAGCGAAACGGACATGC
CAAAAAGTACATGTAGCCCGGATCGGGCAGAGATCAATCGATGGCATTCT
GTGCCACATTCGGCTTGTATATAGAATTAGATTCCGCTTGGAGACTCGAC
TGTTTAACGCTTAGCCAGGCCGTCATCCCGTTTACTCTGTTAACAATGTC
GACCAATAAATAACGCGAAAGTTTGGTATCAGTTGCTGATGTGAATCGAA
ATTAATCCAGTTGTGTATCAGCAGATAACGCTTATCTTTTTCAGATAGTA
AATGCAGCGTAAATCTCATGGCGACAAAGTAAAATATATATAAATATGTA
TAATTAAAGTATTGTTTTAAAGTTTCCCATAGAAACTTGACAAACCTTTA
GATGTCAACTGAAAAAAAAAAAAAAAA

RH04670.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-RA 1937 CG5196-RA 166..1875 3..1712 8535 99.9 Plus
CG5196-RB 2060 CG5196-RB 539..2060 144..1665 7595 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8236423..8237203 931..1711 3905 100 Plus
chr3R 27901430 chr3R 8235849..8236369 411..931 2575 99.6 Plus
chr3R 27901430 chr3R 8234644..8234829 144..329 930 100 Plus
chr3R 27901430 chr3R 8233721..8233862 3..144 710 100 Plus
chr3R 27901430 chr3R 8235662..8235747 327..412 430 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-RA 1284 CG5196-PA 1..1284 83..1366 6405 99.9 Plus
CG5196-RB 1188 CG5196-PB 1..1188 179..1366 5925 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-RA 1679 CG5196-RA 17..1679 3..1665 8300 99.9 Plus
CG5196-RB 2023 CG5196-RB 502..2023 144..1665 7595 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-PA 427 CG5196-PA 1..427 83..1363 2288 100 Plus
CG5196-PB 395 CG5196-PB 1..395 179..1363 2118 100 Plus
CG4483-PA 435 CG4483-PA 10..383 107..1243 1051 49.1 Plus
Dnz1-PA 276 CG6627-PA 104..235 359..784 225 33.8 Plus
CG8314-PA 293 CG8314-PA 87..273 269..832 224 27.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12411034..12411815 931..1712 3910 100 Plus
3R 32079331 3R 12410460..12410980 411..931 2590 99.8 Plus
3R 32079331 3R 12409255..12409440 144..329 930 100 Plus
3R 32079331 3R 12408332..12408473 3..144 710 100 Plus
3R 32079331 3R 12410273..12410358 327..412 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12151865..12152646 931..1712 3910 100 Plus
3R 31820162 3R 12151291..12151811 411..931 2590 99.8 Plus
3R 31820162 3R 12150086..12150271 144..329 930 100 Plus
3R 31820162 3R 12149163..12149304 3..144 710 100 Plus
3R 31820162 3R 12151104..12151189 327..412 430 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:23:25 has no hits.

RH04670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:52:57 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8236424..8237203 932..1711 96   Plus
chr3R 8235849..8236369 411..931 99 -> Plus
chr3R 8235664..8235745 329..410 100 -> Plus
chr3R 8234644..8234828 144..328 100 -> Plus
chr3R 8233717..8233861 1..143 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:24 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 1..1284 83..1366 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:25 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 1..1284 83..1366 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:03:17 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 1..1284 83..1366 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:57 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 1..1284 83..1366 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-13 09:25:13 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 7..1563 1..1555 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:25 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 7..1563 1..1555 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:03:17 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 13..1679 1..1665 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:57 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 13..1679 1..1665 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:52:57 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12411035..12411814 932..1711 100   Plus
3R 12410460..12410980 411..931 99 -> Plus
3R 12410275..12410356 329..410 100 -> Plus
3R 12409255..12409439 144..328 100 -> Plus
3R 12408328..12408472 1..143 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:03:17 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8236757..8237536 932..1711 100   Plus
arm_3R 8236182..8236702 411..931 99 -> Plus
arm_3R 8235997..8236078 329..410 100 -> Plus
arm_3R 8234977..8235161 144..328 100 -> Plus
arm_3R 8234050..8234194 1..143 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:41 Download gff for RH04670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12151866..12152645 932..1711 100   Plus
3R 12151291..12151811 411..931 99 -> Plus
3R 12151106..12151187 329..410 100 -> Plus
3R 12150086..12150270 144..328 100 -> Plus
3R 12149159..12149303 1..143 98 -> Plus

RH04670.pep Sequence

Translation from 82 to 1365

> RH04670.pep
MSPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQ
ALFLLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYK
APRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQG
TVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVI
GLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGW
RANLRLVFNDECQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTF
KCTRPVTGRWLPIFSQGWRVCVAAPCSDEPRISLRPNDMIKVTRFRNHWL
FGERVLSEQELAGVKKRQRKGPIRGWFPRRSAVEVIEAVHEGSGDGNSET
PAPAAQNGNAHSHLKQQQRNGHAKKYM*

RH04670.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17953-PA 427 GF17953-PA 1..427 1..427 2035 86.7 Plus
Dana\GF23581-PA 494 GF23581-PA 8..411 8..415 988 46.4 Plus
Dana\GF13331-PA 295 GF13331-PA 59..275 33..250 243 27.7 Plus
Dana\GF23277-PA 381 GF23277-PA 106..213 53..171 239 40.3 Plus
Dana\GF14058-PA 275 GF14058-PA 27..234 22..234 231 28.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18872-PA 428 GG18872-PA 1..428 1..427 2235 96.3 Plus
Dere\GG15033-PA 443 GG15033-PA 1..416 1..421 1037 45 Plus
Dere\GG22313-PA 293 GG22313-PA 57..273 33..250 238 27.2 Plus
Dere\GG10348-PA 276 GG10348-PA 27..235 22..234 226 30.3 Plus
Dere\GG11528-PA 381 GG11528-PA 106..194 53..148 221 44.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13870-PA 419 GH13870-PA 1..419 1..427 1830 78.9 Plus
Dgri\GH15638-PA 417 GH15638-PA 10..412 8..421 1118 52.2 Plus
Dgri\GH18968-PA 381 GH18968-PA 113..194 62..148 238 47.7 Plus
Dgri\GH19831-PA 290 GH19831-PA 58..270 39..250 230 27.3 Plus
Dgri\GH13330-PA 278 GH13330-PA 27..237 22..234 225 28.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-PA 427 CG5196-PA 1..427 1..427 2354 100 Plus
CG5196-PB 395 CG5196-PB 1..395 33..427 2184 100 Plus
CG4483-PA 435 CG4483-PA 10..383 9..387 1066 49.1 Plus
CG8314-PA 293 CG8314-PA 39..273 23..250 243 26.9 Plus
Dnz1-PA 276 CG6627-PA 27..235 22..234 237 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24824-PA 425 GI24824-PA 1..425 1..427 1891 81.1 Plus
Dmoj\GI12685-PA 413 GI12685-PA 13..398 11..411 1010 51.6 Plus
Dmoj\GI20419-PA 290 GI20419-PA 62..270 41..250 232 27.3 Plus
Dmoj\GI23298-PA 381 GI23298-PA 106..213 53..171 227 40.2 Plus
Dmoj\GI17805-PA 277 GI17805-PA 27..236 22..234 224 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27308-PA 426 GL27308-PA 1..426 1..427 1874 80.6 Plus
Dper\GL12230-PA 418 GL12230-PA 6..417 5..418 1021 46.5 Plus
Dper\GL23902-PA 381 GL23902-PA 106..213 53..171 235 43.3 Plus
Dper\GL20650-PA 286 GL20650-PA 48..266 31..250 233 26.5 Plus
Dper\GL19029-PA 275 GL19029-PA 27..234 22..234 228 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18728-PA 426 GA18728-PA 1..426 1..427 1871 80.6 Plus
Dpse\GA26234-PA 426 GA26234-PA 6..417 5..418 1005 46.5 Plus
Dpse\GA27100-PA 381 GA27100-PA 106..213 53..171 235 43.3 Plus
Dpse\GA20978-PA 286 GA20978-PA 50..266 33..250 231 26.8 Plus
Dpse\GA19735-PA 275 GA19735-PA 27..234 22..234 228 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24028-PA 427 GM24028-PA 1..427 1..427 2284 97.9 Plus
Dsec\GM15471-PA 336 GM15471-PA 2..336 93..427 1764 96.4 Plus
Dsec\GM24887-PA 435 GM24887-PA 1..403 1..410 1050 48.3 Plus
Dsec\GM20103-PA 293 GM20103-PA 55..273 31..250 238 27 Plus
Dsec\GM11347-PA 276 GM11347-PA 27..235 22..234 225 28.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18828-PA 427 GD18828-PA 1..427 1..427 2293 98.6 Plus
Dsim\GD12938-PA 418 GD12938-PA 1..415 1..423 1056 47.7 Plus
Dsim\GD25579-PA 293 GD25579-PA 57..273 33..250 239 27.2 Plus
Dsim\GD22217-PA 276 GD22217-PA 27..235 22..234 225 28.5 Plus
Dsim\GD26013-PA 440 GD26013-PA 60..323 52..299 211 26.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24468-PA 425 GJ24468-PA 1..425 1..427 1854 79.3 Plus
Dvir\GJ12670-PA 421 GJ12670-PA 3..393 1..395 1130 54.9 Plus
Dvir\GJ24153-PA 382 GJ24153-PA 106..213 53..171 243 42.9 Plus
Dvir\GJ20091-PA 289 GJ20091-PA 57..269 39..250 232 28.6 Plus
Dvir\GJ17630-PA 277 GJ17630-PA 27..236 22..234 223 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14400-PA 422 GK14400-PA 1..422 5..427 1871 80.3 Plus
Dwil\GK24311-PA 391 GK24311-PA 2..391 5..399 1164 50.4 Plus
Dwil\GK22100-PA 291 GK22100-PA 55..271 33..250 238 27.7 Plus
Dwil\GK18372-PA 275 GK18372-PA 27..234 22..234 230 28.6 Plus
Dwil\GK11281-PA 381 GK11281-PA 113..194 62..148 226 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26189-PA 428 GE26189-PA 1..428 1..427 2231 96.3 Plus
Dyak\GE21257-PA 441 GE21257-PA 9..381 8..387 1022 50.4 Plus
Dyak\GE14111-PA 293 GE14111-PA 63..273 39..250 237 27.5 Plus
Dyak\GE13229-PA 276 GE13229-PA 27..235 22..234 225 28.5 Plus
Dyak\GE23718-PA 381 GE23718-PA 106..194 53..148 221 44.3 Plus

RH04670.hyp Sequence

Translation from 82 to 1365

> RH04670.hyp
MSPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQ
ALFLLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYK
APRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQG
TVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVI
GLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGW
RANLRLVFNDECQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTF
KCTRPVTGRWLPIFSQGWRVCVAAPCSDEPRISLRPNDMIKVTRFRNHWL
FGERVLSEQELAGVKKRQRKGPIRGWFPRRSAVEVIEAVHEGSGDGNSET
PAPAAQNGNAHSHLKQQQRNGHAKKYM*

RH04670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-PA 427 CG5196-PA 1..427 1..427 2354 100 Plus
CG5196-PB 395 CG5196-PB 1..395 33..427 2184 100 Plus
CG4483-PA 435 CG4483-PA 10..383 9..387 1066 49.1 Plus
CG8314-PA 293 CG8314-PA 39..273 23..250 243 26.9 Plus
Dnz1-PA 276 CG6627-PA 27..235 22..234 237 29.4 Plus