Clone RH04788 Report

Search the DGRC for RH04788

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:47
Well:88
Vector:pFlc-1
Associated Gene/Transcript5-HT2A-RD
Protein status:RH04788.pep: gold
Sequenced Size:3189

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1056 2003-01-01 Sim4 clustering to Release 3
CG1056 2004-07-02 Blastp of sequenced clone
5-HT2 2008-04-29 Release 5.5 accounting
5-HT2 2008-08-15 Release 5.9 accounting
5-HT2 2008-12-18 5.12 accounting

Clone Sequence Records

RH04788.complete Sequence

3189 bp (3189 high quality bases) assembled on 2004-07-02

GenBank Submission: BT015194

> RH04788.complete
GAGTTTGTTTTGAAATTTCGCCGCGATGCGTTCGCTTTCAGAGCGCTCTC
TGCACTCTTACAGAAATAATTATTAAACACGATAAATACTCTAAAAAAAA
AAATAATTCAGAAAATGGATACGAAAGTTATTAGTTAAAGATATTACGGA
ACACCTTAAACCGATTTTAACGACTGAAATGGGTGAAAGGTACTGCAAAA
AGTACTGGTTAAATAATGTTGAATACGCAAGAACAGTTGTCAGGTGCAGT
AAAAGTGTGAAAAAATAAGGAAAAAAGTTTAAAAGGAAACAATTAAATGT
GCAAATAACTAAAATATATATGTGCCGTTGCCAAACGACTGCAAAATGTG
GGTCTTAGGATAAAGTTTTTACAAATTCATTTAAAGCCTATTCTAATTTT
AAAATGTGTATTAATAAAGAAACAAATCAAAGAAAGGAAAAGTAAGACAG
GCAGCTAATTAAGTTTAGTACAAAAACAAACCTTCTTTGTATTGCTCTGT
ACAACAGACACATCTGCGAGGAGGAAGCCCCACAGCTTTAGAATGAAATG
GAGATGCAAAGCTACTCTGGTCGTGGACCATCGACAGGCACATCAGAAAC
AGCAACAGCAACAGCAGCAGTTGCATCTGCATCTGCATCAGACACAGCAG
CAACATTCACACTGCGACACTTCAATTGTCGGCTGGAAGAGGCGGATTGG
CCTGGGCCTCGCCAGCCGTTTATTGACTGCGAAGGCAGCCACACCAACAG
CACATCCTACACCCCCAGCAGCCTGCCCACCAGCAAAAACCTCATCGAGG
GACCCAACAACACATTCCAGTGTGCACGGCAAGCTATCGACGAAGCGGAG
CACAACGCATTCTATAGTTGCGATGGGGAAAGCCCATTGTCTGAAAACTG
CACTTTGAGGCTGAAGGCGCGACTGTTGCGATGGCCGTACGAGGCGTATG
AGCACATTCGACTGGCAATCAACGGGGCACTCAGTGATTATGCTAGTGAT
AAACTTAGTGATAGTTCGAGCTGCGATGAAGGAGGCATGGTGTTGCAATG
TAAGCTGGGCCAGGCCCATGAACTATTGCTTTGTCATTTGCAACAACTCG
AGAGGGAGCCACTGCGGGAGGTGGGAAGCGCGGAGGAGAGCTTCTCCAAC
GACAGCCTTCTGCAGGCCTTTCAAATCGAACTGGGCGCAGAGCGCGATGG
ACTCTGGTCCTTCCTTAATCTAAGCGAGCTAATGGAGCCCGATCACGGAT
TCCTGGGCATCATGAATGTCACCAACACTAGCTTAGACATGTTTTTGCCG
AACCTTACAGCCCTGAACACGACCTCCACGGCCTCCACTGCAGACATGGC
CACCGAGTTCGCGGTAACAAAGAGCTTTCTGGACTACAGTCCCCACGGCT
ACGATTTCCTATTCCTGTTCGTGGTGTTCTTTATCTTCGCGGGTGGCCTG
GGTAATATCCTTGTGTGCCTAGCCGTTGCCTTGGACCGGAAACTGCAGAA
TGTGACTAACTACTTCCTGTTTTCCCTGGCTATAGCCGATCTCCTGGTCA
GTTTGTTTGTGATGCCCATGGGCGCGATACCAGCTTTTTTGGGGTATTGG
CCACTTGGCTTTACCTGGTGCAACATTTATGTGACGTGTGACGTACTGGC
CTGCTCATCCAGTATATTGCACATGTGCTTCATCAGTTTGGGACGCTATA
TGGGAATAAGAAATCCATTGGGCTCGAGGCATCGATCTACGAAACGATTG
ACTGGTATAAAGATAGCCATTGTTTGGGTAATGGCCATGATGGTATCCAG
TTCAATAACCGTTCTTGGTCTGGTCAATGAGAAGAACATAATGCCCGAGC
CTAACATATGCGTTATCAACAATCGCGCCTTTTTCGTGTTTGGATCTCTG
GTAGCTTTTTATATACCCATGCTGATGATGGTTACCACATACGCATTGAC
GATTCCCCTCCTCCGGAAGAAAGCGCGATTTGCCGCCGAGCACCCGGAAA
GTGAACTTTTTCGCAGGTTGGGTGGACGCTTCACCCTAAGGCCGCAGCAC
AGCCAGCAGCAGTTGCAGATGTTCAGTAGCTTTTCTGGCAGCAATAACAA
ATTCCTATCAATGGGCGACGGCAATCGCAACTTCAACACTGAAGGAGAGA
TGGAGGAGGGTGGAGCTCCTAGCAGAAGGAGTGGCGTAGAGCCCGCCGAA
CGACCTTTGATGCAACAGCGAACGGCGAGCAGCAGGAGCATGGGCACGGT
TAGTTTCCGTAATGTCGTGAACGGGACTAGCGGAGCCGCAGGAAGTGGGC
GCAGGACGACTGGCACTGCCCACAGCAGCTTCCGGTTCTCTGGCGCCGGC
ATCTTTCGGCACTCGTCGTCGTCTCCCGCCTCGAGCTGCCACTCCACCAG
CACGTCGCGTTCGAGCTCCTTCTGGCGCAAACACGGCGGCTATCCAAACC
TAATGGACAGGTAATAGGAAAACACCTGAAGACATAATTACGTGGTGGTG
ACTTACTGCAAATTATGATTAGATAATTCCCAAGGCGAGAGTCCACGATG
GCACTGAGGGTGGGCGAAAGGTTTTTAACTCAAATAATAGAAAGCTAAAA
AAAAAATCTCTTAAGTTGTTTATCGATAGAAATTCGCTAGACAAGTAATA
CGAATCTAGCATAATATAATATATAATGTCGGGCAAAGTATATTTTTTAA
AAGTTCTGTTCAACTAAACTAAACAAATGTTTTTCATCAAGTAATCTTAT
CGTTGAAATGCTTCATTATCATCTGTTGTGTAAGATTATGATTATGTAAG
CTACTGAGAAATCCTGATTTAGAAATCATAATCATAAAGGAATTCGTAAA
GGAAAGGAATCATAAAGGAATTCAGAATTCATGAGCGATTTAGATCATAT
GCCACGTGAGATAGTAGTTCACAAGCCTGCACGTCTCACAATATTAATAA
AATAGAGCGATAAAATCAGTCGACCTAAGGACCAAGGACAAGAGGTAATG
AACGAATAAGAGCTTCGCTTTTTTGGCATTTTTTGTATGTCGCAAAAAAC
TTCATAAAAGTGTATGAATTTCTAATGAGGAAGGGGTCCCCGGCCAAACT
ACCCATGGGAAATATGACAAGTTTTTCCCCTGTGCTACTCGTACAAAAAA
TAAAGGTGTTTTCTTTACAAATTAAAAAAAAAAAAAAAA

RH04788.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2-RD 3173 5-HT2-RD 2..3173 2..3173 15860 100 Plus
5-HT2.a 4313 5-HT2.a 2..2460 2..2460 12295 100 Plus
5-HT2-RB 3717 5-HT2-RB 2..2460 2..2460 12295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 453613..454772 2014..3173 5800 100 Plus
chr3R 27901430 chr3R 448219..449335 477..1593 5585 100 Plus
chr3R 27901430 chr3R 438586..439060 2..476 2375 100 Plus
chr3R 27901430 chr3R 452675..452909 1585..1819 1145 99.1 Plus
chr3R 27901430 chr3R 452968..453169 1817..2018 1010 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-RD 1917 CG1056-PD 1..1917 548..2464 9585 100 Plus
5-HT2A-RH 2754 CG1056-PH 1..1913 548..2460 9565 100 Plus
5-HT2A-RF 2751 CG1056-PF 1..1913 548..2460 9565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-RD 3178 CG1056-RD 7..3178 2..3173 15860 100 Plus
5-HT2A-RH 3683 CG1056-RH 7..2465 2..2460 12295 100 Plus
5-HT2A-RB 3722 CG1056-RB 7..2465 2..2460 12295 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-PD 638 CG1056-PD 1..638 548..2461 2455 100 Plus
5-HT2A-PB 930 CG1056-PB 1..638 548..2461 2455 100 Plus
5-HT2A-PA 868 CG1056-PA 1..638 548..2461 2455 100 Plus
5-HT2A-PH 917 CG1056-PH 1..637 548..2458 2450 100 Plus
5-HT2A-PF 916 CG1056-PF 1..637 548..2458 2450 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4627903..4629063 2014..3174 5805 100 Plus
3R 32079331 3R 4622509..4623625 477..1593 5585 100 Plus
3R 32079331 3R 4612876..4613350 2..476 2375 100 Plus
3R 32079331 3R 4626965..4627199 1585..1819 1145 99.1 Plus
3R 32079331 3R 4627258..4627459 1817..2018 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4368734..4369894 2014..3174 5805 100 Plus
3R 31820162 3R 4363340..4364456 477..1593 5585 100 Plus
3R 31820162 3R 4353707..4354181 2..476 2375 100 Plus
3R 31820162 3R 4367796..4368030 1585..1819 1145 99.1 Plus
3R 31820162 3R 4368089..4368290 1817..2018 1010 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:23:10 has no hits.

RH04788.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:56:14 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 453616..454772 2017..3173 100   Plus
chr3R 452969..453167 1818..2016 100 -> Plus
chr3R 452683..452907 1593..1817 100 -> Plus
chr3R 448398..449334 656..1592 100 -> Plus
chr3R 448219..448320 477..578 100 == Plus
chr3R 438585..439060 1..476 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:46:02 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 1..1917 548..2464 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:35:42 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 1..1917 548..2464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:22:57 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 1..1917 548..2464 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:19:33 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RC 1..1915 548..2463 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:14 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2A-RD 1..1917 548..2464 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:46:01 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 2..3173 2..3173 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:35:42 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 2..3173 2..3173 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:22:57 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RD 6..3178 1..3173 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:19:33 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2-RC 2..2462 2..2463 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:14 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
5-HT2A-RD 6..3178 1..3173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:56:14 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4627906..4629062 2017..3173 100   Plus
3R 4627259..4627457 1818..2016 100 -> Plus
3R 4626973..4627197 1593..1817 100 -> Plus
3R 4622509..4623624 477..1592 100 -> Plus
3R 4612875..4613350 1..476 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:22:57 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 453628..454784 2017..3173 100   Plus
arm_3R 452981..453179 1818..2016 100 -> Plus
arm_3R 452695..452919 1593..1817 100 -> Plus
arm_3R 448231..449346 477..1592 100 -> Plus
arm_3R 438597..439072 1..476 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:56:47 Download gff for RH04788.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4368737..4369893 2017..3173 100   Plus
3R 4368090..4368288 1818..2016 100 -> Plus
3R 4367804..4368028 1593..1817 100 -> Plus
3R 4363340..4364455 477..1592 100 -> Plus
3R 4353706..4354181 1..476 99 -> Plus

RH04788.pep Sequence

Translation from 547 to 2463

> RH04788.pep
MEMQSYSGRGPSTGTSETATATAAVASASASDTAATFTLRHFNCRLEEAD
WPGPRQPFIDCEGSHTNSTSYTPSSLPTSKNLIEGPNNTFQCARQAIDEA
EHNAFYSCDGESPLSENCTLRLKARLLRWPYEAYEHIRLAINGALSDYAS
DKLSDSSSCDEGGMVLQCKLGQAHELLLCHLQQLEREPLREVGSAEESFS
NDSLLQAFQIELGAERDGLWSFLNLSELMEPDHGFLGIMNVTNTSLDMFL
PNLTALNTTSTASTADMATEFAVTKSFLDYSPHGYDFLFLFVVFFIFAGG
LGNILVCLAVALDRKLQNVTNYFLFSLAIADLLVSLFVMPMGAIPAFLGY
WPLGFTWCNIYVTCDVLACSSSILHMCFISLGRYMGIRNPLGSRHRSTKR
LTGIKIAIVWVMAMMVSSSITVLGLVNEKNIMPEPNICVINNRAFFVFGS
LVAFYIPMLMMVTTYALTIPLLRKKARFAAEHPESELFRRLGGRFTLRPQ
HSQQQLQMFSSFSGSNNKFLSMGDGNRNFNTEGEMEEGGAPSRRSGVEPA
ERPLMQQRTASSRSMGTVSFRNVVNGTSGAAGSGRRTTGTAHSSFRFSGA
GIFRHSSSSPASSCHSTSTSRSSSFWRKHGGYPNLMDR*

RH04788.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 05:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16662-PA 863 GF16662-PA 1..637 1..637 1824 66.1 Plus
Dana\GF18663-PA 945 GF18663-PA 105..277 302..475 404 42.5 Plus
Dana\GF18173-PA 599 GF18173-PA 74..283 251..466 340 37 Plus
Dana\GF20457-PA 534 GF20457-PA 41..256 234..465 329 35.6 Plus
Dana\GF23300-PA 528 GF23300-PA 92..363 257..531 318 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 05:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12484-PA 712 GG12484-PA 1..641 1..638 2456 82.9 Plus
Dere\GG16756-PA 631 GG16756-PA 101..291 283..466 340 38.7 Plus
Dere\GG11898-PA 560 GG11898-PA 130..356 257..486 317 35 Plus
Dere\GG21429-PA 496 GG21429-PA 133..359 290..508 301 32.2 Plus
Dere\GG16242-PA 601 GG16242-PA 114..289 290..465 296 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 05:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18091-PA 884 GH18091-PA 1..638 1..637 1607 57.1 Plus
Dgri\GH24329-PA 934 GH24329-PA 380..621 243..487 360 37.5 Plus
Dgri\GH15850-PA 620 GH15850-PA 109..303 282..475 337 37.9 Plus
Dgri\GH14351-PA 593 GH14351-PA 195..359 301..465 307 40.1 Plus
Dgri\GH14438-PA 617 GH14438-PA 136..327 290..481 301 33.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-PD 638 CG1056-PD 1..638 1..638 3322 100 Plus
5-HT2A-PB 930 CG1056-PB 1..638 1..638 3322 100 Plus
5-HT2A-PA 868 CG1056-PA 1..638 1..638 3322 100 Plus
5-HT2A-PH 917 CG1056-PH 1..637 1..637 3317 100 Plus
5-HT2A-PF 916 CG1056-PF 1..637 1..637 3317 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 05:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24591-PA 947 GI24591-PA 1..668 1..637 1475 55.2 Plus
Dmoj\GI22528-PA 942 GI22528-PA 19..349 211..537 423 30.2 Plus
Dmoj\GI23635-PA 606 GI23635-PA 86..301 283..490 348 36.1 Plus
Dmoj\GI14816-PA 585 GI14816-PA 39..274 252..487 347 36.7 Plus
Dmoj\GI10445-PA 575 GI10445-PA 175..339 301..465 311 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 05:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22070-PA 966 GL22070-PA 1..663 1..637 1919 64.3 Plus
Dper\GL23028-PA 411 GL23028-PA 89..269 302..482 390 41.8 Plus
Dper\GL12926-PA 883 GL12926-PA 363..565 285..487 351 39.1 Plus
Dper\GL12239-PA 674 GL12239-PA 139..329 283..466 338 39.2 Plus
Dper\GL13974-PA 592 GL13974-PA 134..406 257..531 325 31.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 05:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10393-PB 964 GA10393-PB 1..661 1..637 1905 64.5 Plus
Dpse\GA20762-PA 918 GA20762-PA 89..339 302..537 409 34.9 Plus
Dpse\GA14269-PA 882 GA14269-PA 362..564 285..487 352 39.1 Plus
Dpse\GA20346-PB 630 GA20346-PB 93..283 283..466 335 39.2 Plus
Dpse\GA11376-PA 573 GA11376-PA 134..406 257..531 325 31.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 05:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10765-PA 870 GM10765-PA 1..640 1..638 2858 92.8 Plus
Dsec\GM15345-PA 631 GM15345-PA 106..296 283..466 340 38.8 Plus
Dsec\GM22697-PA 763 GM22697-PA 312..527 234..465 336 35.6 Plus
Dsec\GM12116-PA 558 GM12116-PA 123..354 252..486 324 35.1 Plus
Dsec\GM25874-PA 496 GM25874-PA 133..359 290..508 303 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 05:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19740-PA 868 GD19740-PA 1..638 1..638 2876 91.6 Plus
Dsim\GD20216-PA 443 GD20216-PA 105..295 283..466 324 39.5 Plus
Dsim\GD16708-PA 556 GD16708-PA 121..352 252..486 319 35.1 Plus
Dsim\GD20445-PA 422 GD20445-PA 59..285 290..508 295 32.2 Plus
Dsim\GD15016-PA 601 GD15016-PA 114..289 290..465 295 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 05:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22656-PA 916 GJ22656-PA 1..625 1..637 1647 58.1 Plus
Dvir\GJ10131-PA 926 GJ10131-PA 80..279 286..485 410 37.8 Plus
Dvir\GJ19479-PA 584 GJ19479-PA 48..272 258..487 347 37.2 Plus
Dvir\GJ24710-PA 578 GJ24710-PA 64..284 250..475 341 36 Plus
Dvir\GJ10661-PA 573 GJ10661-PA 173..355 301..486 310 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 05:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13828-PA 994 GK13828-PA 1..702 1..638 1592 55.4 Plus
Dwil\GK16340-PA 587 GK16340-PA 75..277 285..487 346 39.1 Plus
Dwil\GK22505-PA 656 GK22505-PA 127..317 283..466 335 38.7 Plus
Dwil\GK13099-PA 556 GK13099-PA 149..372 290..526 314 34 Plus
Dwil\GK10900-PA 492 GK10900-PA 130..312 290..465 300 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 05:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25425-PA 689 GE25425-PA 18..203 350..536 875 86.1 Plus
Dyak\GE25425-PA 689 GE25425-PA 202..406 422..638 722 71 Plus
Dyak\GE17345-PA 882 GE17345-PA 322..562 234..487 352 36 Plus
Dyak\GE25251-PA 623 GE25251-PA 97..287 283..466 338 38.7 Plus
Dyak\GE23347-PA 566 GE23347-PA 131..362 252..486 318 35.1 Plus
Dyak\GE10051-PA 494 GE10051-PA 131..357 290..508 299 32.2 Plus

RH04788.hyp Sequence

Translation from 547 to 2463

> RH04788.hyp
MEMQSYSGRGPSTGTSETATATAAVASASASDTAATFTLRHFNCRLEEAD
WPGPRQPFIDCEGSHTNSTSYTPSSLPTSKNLIEGPNNTFQCARQAIDEA
EHNAFYSCDGESPLSENCTLRLKARLLRWPYEAYEHIRLAINGALSDYAS
DKLSDSSSCDEGGMVLQCKLGQAHELLLCHLQQLEREPLREVGSAEESFS
NDSLLQAFQIELGAERDGLWSFLNLSELMEPDHGFLGIMNVTNTSLDMFL
PNLTALNTTSTASTADMATEFAVTKSFLDYSPHGYDFLFLFVVFFIFAGG
LGNILVCLAVALDRKLQNVTNYFLFSLAIADLLVSLFVMPMGAIPAFLGY
WPLGFTWCNIYVTCDVLACSSSILHMCFISLGRYMGIRNPLGSRHRSTKR
LTGIKIAIVWVMAMMVSSSITVLGLVNEKNIMPEPNICVINNRAFFVFGS
LVAFYIPMLMMVTTYALTIPLLRKKARFAAEHPESELFRRLGGRFTLRPQ
HSQQQLQMFSSFSGSNNKFLSMGDGNRNFNTEGEMEEGGAPSRRSGVEPA
ERPLMQQRTASSRSMGTVSFRNVVNGTSGAAGSGRRTTGTAHSSFRFSGA
GIFRHSSSSPASSCHSTSTSRSSSFWRKHGGYPNLMDR*

RH04788.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
5-HT2A-PD 638 CG1056-PD 1..638 1..638 3322 100 Plus
5-HT2A-PB 930 CG1056-PB 1..638 1..638 3322 100 Plus
5-HT2A-PA 868 CG1056-PA 1..638 1..638 3322 100 Plus
5-HT2A-PH 917 CG1056-PH 1..637 1..637 3317 100 Plus
5-HT2A-PF 916 CG1056-PF 1..637 1..637 3317 100 Plus