Clone RH05939 Report

Search the DGRC for RH05939

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:59
Well:39
Vector:pFlc-1
Associated Gene/TranscriptPu-RB
Protein status:RH05939.pep: gold
Sequenced Size:1636

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pu-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH05939.complete Sequence

1636 bp assembled on 2009-08-11

GenBank Submission: BT099546.1

> RH05939.complete
GAGTCGGCAGATAAATTCGGAGCGAGCGCGCCAAATACAAAAGTCCGCCA
CGCGTTCAGAGCCCCAATCTCAAGTCCCATAGTTCAAACAGTTCCGAGCC
CGTGTCCTCGCAGAGTCCACCAATCCCAGCCAAACATCAACTCCAATCAA
TCGAACATGAAGCCCCAGACAAGCGAGCAAAATGGCAGTGGCCAAAATGG
CGAGGGTGCCGCAGATGCCGTGGCCGTTGCCACGATCCCCACGGGCGAAG
CCTCCGCCGCCTCCGCCACGTCCGGCACCGATCTAACGGTCTCCAAAAAC
AGCCAGCAGCTGAAACTGGAAATGCTCAACTTGGAGCTGGCCAGCAATGG
AAGCGGCCACGAGAAGTGCACGTTCCACCACGACCTGGAGCTGGACCACA
AGCCGCCGACGCGAGAGGCCCTCCTTCCGGACATGGCACGCTCGTATCGT
CTACTCTTGGGCGGCCTGGGCGAGAATCCCGATCGCCAGGGACTGATCAA
GACGCCGGAGCGGGCAGCCAAGGCCATGCTGTACTTCACCAAGGGCTACG
ACCAGAGTCTCGAGGATGTTCTCAATGGCGCCGTTTTCGACGAGGATCAT
GACGAAATGGTGGTGGTCAAGGATATTGAAATGTTCTCCATGTGCGAGCA
TCATCTGGTGCCCTTCTACGGCAAAGTTTCCATCGGTTATTTGCCGTGCA
ACAAGATTCTCGGACTCAGTAAATTGGCACGCATTGTCGAAATATTTTCG
CGTCGCCTGCAAGTCCAGGAGCGCTTAACTAAGCAGATCGCAGTGGCCGT
GACTCAGGCCGTGCAACCCGCTGGAGTAGCAGTGGTCGTAGAGGGAGTCC
ACATGTGCATGGTGATGCGTGGCGTGCAGAAGATCAACAGCAAAACTGTT
ACCTCAACTATGCTGGGCGTGTTCCGAGACGATCCCAAGACCCGTGAGGA
ATTCCTGAACTTAGTCAATAGCAAATAGAGTGGGCACTAGAGGACCCTAC
TGAAATCCGAGACCAACTAAACCCCTACAATATTTTTGGAGGCGCTTATA
TACAAACAAACAAAAATGAAACGAAACACAGGGTCCATTAGTTTATGTTT
TTAGGATTGATTTCATTTAGTTAGTGCAATGATTGCGCAGCCATTTTCCT
TGTTGATTTGTGTAAAAATTGTTGAAAAATTTTGTTAGCAAAATACGTTT
TTTAGATAGATGAATGTAATGAGAAGCGAGATTCGAAGAGGACGAGATTT
GAATACCGGTGTTGGGTAGTTTTATGTTCAATATTATATGCAGTTTTATG
GCACTTGAACGATAATTTTTACAACGTATACATACGATTAATGCATTGTG
CAATAAGGGAACAACTGATAATAAATCACGGCAAATTGTTTAGGGAATTT
ACAATTTATAAACAGTTCACATCAAATTAATCAGATCTATAGTTATGTAT
GTATGTTAACCTATATAAAGAGTTGCATTCATAATGTTCCTCGACAGGGA
CCAAAGTATATTGGAAGATTTTAAATGTTAAAATTATATGCTCATTATGT
AAATGACGTTGCTTGTAGTGAGTCAAAGCTGCTTATTAATTATACAATAA
ATTATGTATTTAAATAACGTTAAAAAAAAAAAAAAA

RH05939.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RB 1673 Pu-RB 46..1669 2..1625 8090 99.8 Plus
Pu-RA 1823 Pu-RA 549..1819 355..1625 6325 99.8 Plus
Pu.b 1806 Pu.b 532..1802 355..1625 6325 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17068294..17069065 849..1621 3740 99.2 Plus
chr2R 21145070 chr2R 17061777..17062131 2..356 1715 98.9 Plus
chr2R 21145070 chr2R 17066400..17066610 355..565 1055 100 Plus
chr2R 21145070 chr2R 17067877..17068043 565..731 835 100 Plus
chr2R 21145070 chr2R 17068102..17068219 731..848 575 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RB 822 CG9441-PB 1..822 157..978 4110 100 Plus
Pu-RA 975 CG9441-PA 352..975 355..978 3120 100 Plus
Pu-RC 927 CG9441-PC 304..927 355..978 3120 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RB 1625 CG9441-RB 6..1625 2..1621 8070 99.9 Plus
Pu-RA 1793 CG9441-RA 527..1793 355..1621 6305 99.8 Plus
Pu-RC 1744 CG9441-RC 478..1744 355..1621 6305 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PB 273 CG9441-PB 1..273 157..975 1205 100 Plus
Pu-PC 308 CG9441-PC 89..308 331..975 964 96.4 Plus
Pu-PA 324 CG9441-PA 114..324 343..975 960 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21181836..21182612 849..1625 3855 99.7 Plus
2R 25286936 2R 21175320..21175674 2..356 1775 100 Plus
2R 25286936 2R 21179937..21180147 355..565 1055 100 Plus
2R 25286936 2R 21181419..21181585 565..731 835 100 Plus
2R 25286936 2R 21181644..21181761 731..848 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21183035..21183811 849..1625 3855 99.7 Plus
2R 25260384 2R 21176519..21176873 2..356 1775 100 Plus
2R 25260384 2R 21181136..21181346 355..565 1055 100 Plus
2R 25260384 2R 21182618..21182784 565..731 835 100 Plus
2R 25260384 2R 21182843..21182960 731..848 590 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:35:49 has no hits.

RH05939.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:33:39 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17068294..17069024 849..1580 99 -> Plus
chr2R 17068103..17068219 732..848 99 -> Plus
chr2R 17067878..17068043 566..731 100 -> Plus
chr2R 17066401..17066610 356..565 100 -> Plus
chr2R 17061776..17062130 1..355 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:39 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 1..822 157..978 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:49 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 1..822 157..978 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:45 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 1..822 157..978 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:33:39 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 1..822 157..978 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 12:39:41 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 3..1623 1..1621 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:49 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 3..1623 1..1621 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:45 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 5..1625 1..1621 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:33:39 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 5..1625 1..1621 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:33:39 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21181836..21182608 849..1621 99   Plus
2R 21181645..21181761 732..848 100 -> Plus
2R 21181420..21181585 566..731 100 -> Plus
2R 21179938..21180147 356..565 100 -> Plus
2R 21175319..21175673 1..355 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:45 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17069341..17070113 849..1621 99   Plus
arm_2R 17069150..17069266 732..848 100 -> Plus
arm_2R 17068925..17069090 566..731 100 -> Plus
arm_2R 17067443..17067652 356..565 100 -> Plus
arm_2R 17062824..17063178 1..355 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:25 Download gff for RH05939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21183035..21183807 849..1621 99   Plus
2R 21182844..21182960 732..848 100 -> Plus
2R 21182619..21182784 566..731 100 -> Plus
2R 21181137..21181346 356..565 100 -> Plus
2R 21176518..21176872 1..355 99 -> Plus

RH05939.pep Sequence

Translation from 0 to 977

> RH05939.pep
ESADKFGASAPNTKVRHAFRAPISSPIVQTVPSPCPRRVHQSQPNINSNQ
SNMKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKN
SQQLKLEMLNLELASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYR
LLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDH
DEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFS
RRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTV
TSTMLGVFRDDPKTREEFLNLVNSK*

RH05939.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11941-PA 285 GF11941-PA 1..285 53..325 1235 88.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22097-PA 271 GG22097-PA 1..271 53..325 1377 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20729-PA 337 GH20729-PA 126..337 114..325 1065 97.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PB 273 CG9441-PB 1..273 53..325 1389 100 Plus
Pu-PC 308 CG9441-PC 30..308 46..325 1090 78.2 Plus
Pu-PA 324 CG9441-PA 30..324 46..325 1072 74.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20812-PA 274 GI20812-PA 1..274 53..325 1146 85.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10161-PA 274 GL10161-PA 1..274 53..325 1148 86.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30270-PA 277 GA30270-PA 1..277 53..325 1149 86.6 Plus
Dpse\GA30270-PB 325 GA30270-PB 115..325 115..325 1127 98.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15814-PA 273 GM15814-PA 1..273 53..325 1452 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11572-PA 273 GD11572-PA 1..273 53..325 1452 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20545-PA 270 GJ20545-PA 1..270 53..325 1167 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21906-PA 321 GK21906-PA 64..321 66..325 1081 83.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12177-PA 271 GE12177-PA 1..271 53..325 1370 98.2 Plus

RH05939.hyp Sequence

Translation from 156 to 977

> RH05939.hyp
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKNSQ
QLKLEMLNLELASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLL
LGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDE
MVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRR
LQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTS
TMLGVFRDDPKTREEFLNLVNSK*

RH05939.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PB 273 CG9441-PB 1..273 1..273 1389 100 Plus
Pu-PC 308 CG9441-PC 58..308 18..273 1088 85.2 Plus
Pu-PA 324 CG9441-PA 114..324 63..273 1071 98.6 Plus