Clone RH10980 Report

Search the DGRC for RH10980

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:109
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG7461-RB
Protein status:RH10980.pep: gold
Sequenced Size:2028

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7461 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RH10980.complete Sequence

2028 bp assembled on 2009-10-14

GenBank Submission: BT100101.1

> RH10980.complete
GACACTGCAGACTCTCGGTCCAAAGGGCGATTTACCAAACAATTTCGAAA
CTATGTGGAGGCACACGATCCAAAGTACCAGGTACCTGGCAGGAAACGCC
TCGCTTTGCAGGCAAATAGCGACGCACAGTCCCAAACTGGGGGCGGAAAG
CAATCGCAGCAAGGAAAAGGCAAGTGAGAATGAGTCCTTTATGGCCAACA
TCTTCCGTGGATCACTGGTGTCAAGCCAAGTGTTCCCGTATCCGGATGTC
CTGACCGCGGAGCAGAAGGAGCTGACCAACAGCCTGATAGATCCGTTCGA
GCGTTTCTTCTCCGATGTCAATGACGCTGCCCGCAACGATGCCAACTCTA
AAATAGATGACACCACTTCGACGGCTCTGTGGGAGCTCGGGGCCTTCGGA
ATCCAAGTGCCATCTGAATTCGGTGGCCTCGGTCTGAACAATACCCAGTA
CGGCAGGCTGTGCGCCATTGTGGGTGTCAACGATCTGGGACTGGGCATCA
CGATTGGCGCCCATCAGAGTATTGGCTTCAAGGGAATACTGCTGTACGGC
ACCCCCGAGCAGAAGGAGAAGTACCTGCCCAAGGTGGCCGCCGAGCAGGT
GTACGCTGCCTTTGCCCTTACGGAACCCAGCTCCGGATCTGATGCGGGTT
CCATTCGATGCCGTGCCGTGAAGAGTGCCGATGGAAAGCACTACGTCCTT
AATGGCTCAAAAATCTGGATTTCCAATGGCGGAATTGCCGAAATTATGAC
CGTTTTCGCACAGACCGAGCAGGTGGACCCGAAGACTGGCGAGAAGAAGG
ACAAGGTCACTGCCTTCATTGTGGAACGATCCTTCGGAGGTGTAACCAAT
GGACCACCGGAGAAGAAAATGGGCATCAAGGCATCGAACACGGCCGAAGT
GTATTTCGAAGATGTAAAGATTCCAATTGAAAATGTGCTCGGCAAGGAAG
GTGATGGATTCAAGGTTGCCATGAACATATTGAACAACGGTCGGTTTGGA
ATGGGCGCCACGCTATCGGGAACAATGAAGAAATGCATCGAACAGGCCAC
CGAGCATGCCAACAATCGAGTTCAGTTTGGTCAAAAACTAAAGAACTATG
GATCCATCCAAGAGAAATTGGCTCAGATGAACATTCTGCAGTACGCCACG
GAGTCGATGGCGTTTACTATTTCACAAAACATGGATGCCGGCAGCAAGGA
CTATCACTTGGAAGCCGCCATCTCGAAGATCTATGCTTCGGAGAGCGCGT
GGTATGTTTGCGACGAGGCTATACAAATTCTGGGCGGCATGGGATACATG
GTGGATAATGGATTGGAACGAGTCCTGCGTGACCTGCGCATTTTCCGCAT
ATTCGAGGGCACCAATGACATTCTCCGGCTGTTCATTGCCCTGACTGGCA
TTCAATATGCGGGATCCCACCTTAAGGAACTGCAGCGCGCATTCAAGAAT
CCCTCGGCCAATTTGGGACTGATTTTCAAAGAGGCCTCCAGGCGGGCGGC
CTCCACTGTCGGCTTGGGCGGCACCGATCTGAGTGGCCACGTAGTGGGTG
AACTCTTGCCTTATGCCAAAAAAACGGCCCATTGTATTGATCTTTTTGGA
CAATCGGTGGAAGAACTATTGCTGCGATACAACAAAAACATAGTTAACGA
ACAAATTTTGCTAACACGACTGGCAAATGCAGCCATTGATATTTATGCAA
TGGTTGTGACGCAATCGCGATCATCCCGTGCAGTCAATCTGAATCTGCCA
ACTGCACAACACGAGCTCAACATGACCAAGGCACTCACTATTCAGGCATC
TGATCGAGTGATTAAGAATCTACAGGCTGCCACATCCAGTCATCATAGGT
CTCTCAATGAGAAGATTTCCACCATCGCCAAGACCACTTTGGAAAATGGC
GGTGTGACTACGACTGGAATCTTGGATCAAAACTAGACCAATATACTTTT
ATACGAATTTTAAGCCCTTGATTGTTAACCTAGTATGAATGCCAATAAAG
TCTTGTAAATAATAAAAAAAAAAAAAAA

RH10980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-RB 2022 CG7461-RB 11..2022 2..2013 10060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15192346..15194356 2..2013 9935 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-RC 1884 CG7461-PC 1..1884 53..1936 9420 100 Plus
CG7461-RB 1884 CG7461-PB 1..1884 53..1936 9420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-RC 2274 CG7461-RC 2..2013 2..2013 10060 100 Plus
CG7461-RB 2013 CG7461-RB 2..2013 2..2013 10060 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-PC 627 CG7461-PC 1..627 53..1933 3185 100 Plus
CG7461-PB 627 CG7461-PB 1..627 53..1933 3185 100 Plus
Arc42-PA 405 CG4703-PA 49..402 323..1429 545 35.2 Plus
CG3902-PA 414 CG3902-PA 64..399 338..1372 524 35.1 Plus
CG12262-PA 419 CG12262-PA 60..408 326..1390 515 35.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19305173..19307186 2..2015 10070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19306372..19308385 2..2015 10070 100 Plus
Blast to na_te.dros performed 2014-11-27 09:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
jockey 5020 jockey DMLINEJA 5020bp Derived from M22874 (g157823) (Rel. 47, Last updated, Version 5). 1378..1432 1927..1978 115 70.9 Plus

RH10980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:45:23 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15192344..15194356 1..2013 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:23 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 1..1884 53..1936 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:59 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 1..1884 53..1936 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:34:43 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 1..1884 53..1936 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:45:23 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 1..1884 53..1936 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-14 10:19:53 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 9..2022 1..2013 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:59 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 9..2022 1..2013 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:34:43 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 2..2013 2..2013 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:45:23 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
CG7461-RB 2..2013 2..2013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:45:23 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19305171..19307184 1..2013 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:34:43 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15192676..15194689 1..2013 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:31 Download gff for RH10980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19306370..19308383 1..2013 99   Plus

RH10980.hyp Sequence

Translation from 0 to 1935

> RH10980.hyp
TLQTLGPKGDLPNNFETMWRHTIQSTRYLAGNASLCRQIATHSPKLGAES
NRSKEKASENESFMANIFRGSLVSSQVFPYPDVLTAEQKELTNSLIDPFE
RFFSDVNDAARNDANSKIDDTTSTALWELGAFGIQVPSEFGGLGLNNTQY
GRLCAIVGVNDLGLGITIGAHQSIGFKGILLYGTPEQKEKYLPKVAAEQV
YAAFALTEPSSGSDAGSIRCRAVKSADGKHYVLNGSKIWISNGGIAEIMT
VFAQTEQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMGIKASNTAEV
YFEDVKIPIENVLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQAT
EHANNRVQFGQKLKNYGSIQEKLAQMNILQYATESMAFTISQNMDAGSKD
YHLEAAISKIYASESAWYVCDEAIQILGGMGYMVDNGLERVLRDLRIFRI
FEGTNDILRLFIALTGIQYAGSHLKELQRAFKNPSANLGLIFKEASRRAA
STVGLGGTDLSGHVVGELLPYAKKTAHCIDLFGQSVEELLLRYNKNIVNE
QILLTRLANAAIDIYAMVVTQSRSSRAVNLNLPTAQHELNMTKALTIQAS
DRVIKNLQAATSSHHRSLNEKISTIAKTTLENGGVTTTGILDQN*

RH10980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-PC 627 CG7461-PC 1..627 18..644 3185 100 Plus
CG7461-PB 627 CG7461-PB 1..627 18..644 3185 100 Plus
Arc42-PA 405 CG4703-PA 49..402 108..476 545 35.2 Plus
CG3902-PA 414 CG3902-PA 64..399 113..457 524 35.1 Plus
CG12262-PA 419 CG12262-PA 60..408 109..463 515 35.6 Plus

RH10980.pep Sequence

Translation from 1 to 1935

> RH10980.pep
TLQTLGPKGDLPNNFETMWRHTIQSTRYLAGNASLCRQIATHSPKLGAES
NRSKEKASENESFMANIFRGSLVSSQVFPYPDVLTAEQKELTNSLIDPFE
RFFSDVNDAARNDANSKIDDTTSTALWELGAFGIQVPSEFGGLGLNNTQY
GRLCAIVGVNDLGLGITIGAHQSIGFKGILLYGTPEQKEKYLPKVAAEQV
YAAFALTEPSSGSDAGSIRCRAVKSADGKHYVLNGSKIWISNGGIAEIMT
VFAQTEQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMGIKASNTAEV
YFEDVKIPIENVLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQAT
EHANNRVQFGQKLKNYGSIQEKLAQMNILQYATESMAFTISQNMDAGSKD
YHLEAAISKIYASESAWYVCDEAIQILGGMGYMVDNGLERVLRDLRIFRI
FEGTNDILRLFIALTGIQYAGSHLKELQRAFKNPSANLGLIFKEASRRAA
STVGLGGTDLSGHVVGELLPYAKKTAHCIDLFGQSVEELLLRYNKNIVNE
QILLTRLANAAIDIYAMVVTQSRSSRAVNLNLPTAQHELNMTKALTIQAS
DRVIKNLQAATSSHHRSLNEKISTIAKTTLENGGVTTTGILDQN*

RH10980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23652-PA 527 GF23652-PA 1..527 118..644 2487 87.3 Plus
Dana\GF17623-PA 405 GF17623-PA 30..402 92..476 547 34 Plus
Dana\GF10656-PA 420 GF10656-PA 37..408 84..463 532 35.1 Plus
Dana\GF10158-PA 419 GF10158-PA 80..410 126..462 519 35.6 Plus
Dana\GF10801-PA 415 GF10801-PA 63..400 111..457 505 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21959-PA 627 GG21959-PA 1..627 18..644 3296 97.8 Plus
Dere\Arc42-PA 405 GG23560-PA 49..402 108..476 550 35.5 Plus
Dere\GG14445-PA 419 GG14445-PA 60..408 109..463 527 35.8 Plus
Dere\GG13447-PA 414 GG13447-PA 62..399 111..457 522 35.3 Plus
Dere\GG17152-PA 415 GG17152-PA 77..405 126..463 494 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15160-PA 578 GH15160-PA 1..578 67..644 2399 75.8 Plus
Dgri\GH16400-PA 406 GH16400-PA 50..403 108..476 540 36.9 Plus
Dgri\GH14704-PA 419 GH14704-PA 36..407 84..463 537 35.6 Plus
Dgri\GH16965-PA 414 GH16965-PA 62..399 111..457 531 36.5 Plus
Dgri\GH22516-PA 424 GH22516-PA 85..415 126..462 509 36.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG7461-PC 627 CG7461-PC 1..627 18..644 3185 100 Plus
CG7461-PB 627 CG7461-PB 1..627 18..644 3185 100 Plus
Arc42-PA 405 CG4703-PA 49..402 108..476 545 35.2 Plus
CG3902-PA 414 CG3902-PA 64..399 113..457 524 35.1 Plus
CG12262-PA 419 CG12262-PA 60..408 109..463 515 35.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12099-PA 581 GI12099-PA 1..581 64..644 2480 78 Plus
Dmoj\GI22432-PA 406 GI22432-PA 1..403 64..476 541 33.9 Plus
Dmoj\GI12250-PA 420 GI12250-PA 36..407 84..463 535 35.4 Plus
Dmoj\GI11829-PA 414 GI11829-PA 62..399 111..457 524 35.9 Plus
Dmoj\GI12421-PA 421 GI12421-PA 31..412 78..462 512 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14800-PA 580 GL14800-PA 1..579 64..642 2620 84.6 Plus
Dper\GL12205-PA 405 GL12205-PA 69..402 128..476 544 37.4 Plus
Dper\GL25250-PA 415 GL25250-PA 63..400 111..457 523 35.6 Plus
Dper\GL25095-PA 419 GL25095-PA 78..408 127..463 522 36.3 Plus
Dper\GL10298-PA 420 GL10298-PA 81..411 126..462 505 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Arc42-PA 405 GA18369-PA 69..402 128..476 544 37.4 Plus
Dpse\GA17761-PA 415 GA17761-PA 63..400 111..457 523 35.6 Plus
Dpse\GA11516-PA 419 GA11516-PA 78..408 127..463 522 36.3 Plus
Dpse\GA19744-PA 420 GA19744-PA 81..411 126..462 505 35.7 Plus
Dpse\GA18485-PA 411 GA18485-PA 73..401 126..463 496 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21947-PA 627 GM21947-PA 1..627 18..644 3330 99 Plus
Dsec\GM26869-PA 405 GM26869-PA 49..402 108..476 545 35 Plus
Dsec\GM24997-PA 419 GM24997-PA 60..408 109..463 529 36.1 Plus
Dsec\GM24928-PA 420 GM24928-PA 81..411 126..462 512 35.7 Plus
Dsec\GM26034-PA 420 GM26034-PA 77..410 126..463 492 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11444-PA 627 GD11444-PA 1..627 18..644 3324 98.9 Plus
Dsim\GD19319-PA 405 GD19319-PA 69..402 128..476 547 36.4 Plus
Dsim\GD14030-PA 439 GD14030-PA 60..408 109..463 532 36.1 Plus
Dsim\GD12323-PA 420 GD12323-PA 62..405 111..457 509 35 Plus
Dsim\GD12977-PA 420 GD12977-PA 81..411 126..462 505 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13373-PA 581 GJ13373-PA 1..579 64..642 2490 77.9 Plus
Dvir\GJ11482-PA 420 GJ11482-PA 36..407 84..463 548 36.4 Plus
Dvir\GJ19560-PA 420 GJ19560-PA 36..407 84..463 548 36.4 Plus
Dvir\GJ10995-PA 406 GJ10995-PA 70..403 128..476 544 37.1 Plus
Dvir\GJ13529-PA 414 GJ13529-PA 62..399 111..457 529 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24068-PA 413 GK24068-PA 1..330 269..598 1531 86.1 Plus
Dwil\GK24067-PA 243 GK24067-PA 32..243 60..273 943 82.2 Plus
Dwil\Arc42-PA 405 GK22361-PA 30..402 92..476 575 35.3 Plus
Dwil\GK23895-PA 420 GK23895-PA 36..407 84..463 534 34.9 Plus
Dwil\GK20439-PA 417 GK20439-PA 65..402 111..457 521 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12038-PA 627 GE12038-PA 1..627 18..644 3293 97.3 Plus
Dyak\GE25631-PA 405 GE25631-PA 30..402 92..476 549 34.3 Plus
Dyak\GE21636-PA 419 GE21636-PA 60..408 109..463 527 35.8 Plus
Dyak\GE22549-PA 414 GE22549-PA 62..399 111..457 518 35.1 Plus
Dyak\GE22545-PA 414 GE22545-PA 62..399 111..457 518 35.1 Plus