Clone RH12261 Report

Search the DGRC for RH12261

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:122
Well:61
Vector:pFlc-1
Associated Gene/TranscriptCG13123-RA
Protein status:RH12261.pep: gold
Preliminary Size:972
Sequenced Size:1102

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13123 2002-01-01 Sim4 clustering to Release 2
CG13123 2002-03-28 Blastp of sequenced clone
CG13123 2003-01-01 Sim4 clustering to Release 3
CG13123 2008-04-29 Release 5.5 accounting
CG13123 2008-08-15 Release 5.9 accounting
CG13123 2008-12-18 5.12 accounting

Clone Sequence Records

RH12261.complete Sequence

1102 bp (1102 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094905

> RH12261.complete
GACACTGTTGTTTACATGGCTGCATTTCTTTGAATGTATTTATATTAACA
TTAACATTACAGTTTATTTACATTAATTAAATAATAAAACCCATGGACCT
GCGTAAACTGTGCCGCATTTGCTTCGTGGACAGCGCTTCGGTGGATATAC
GGGAGCACAGGAGCGGTGGCAGTTCGGATCAGACAGTCCTCCAGCTGATA
GAAGCCATGTTCGGCTGGAACATAGCACTTAATCTTACTGAGGAGCTGCC
CATGATCTGTAATGATTGCTTGGAAGATTGCCTGCAGCAGTACGCCTTCT
TCAGGAAGCTAACGTTCGCCAATCAGCAGCTACTGCAGCTCTACAACGAG
GCGGAGGTAGAAATGTGCCAAGTTAAGATGGACGCAACGGAGGAAGAGCC
CGAAAACCAGGCTAGTGATGAATTCGAGATACTGGAGGAATTCAGGAGGA
TACCACTGGATTATGTGGTTTTAGACCCCGATCGTCCTACAGAAACAAGA
CAAACGAGGAGAAGGACGGATAGCTGTACGAAACCCTCTCAAAGGCTGGC
CAACCAAGATTCGCTGATTGTCTCCGAGTTTTTACCTGCCACCACAGCCC
AACCACGACTGGATCTATCCGACTCTCAGCTGGAGCAACTGGAATCCCCA
GCATACGAGATGCGCACCGTGGACTATGCTGCCGTCGAACTGAAACACTA
CAACCTGGACGAGTACAACGAGGCCAATCGCCTGCTGGACGTGGAGCCCA
GTGGCAGCCAGGCCATCTACAAGTGCCAGTACTGCCCACTGGCTTATGCC
TCGCCTCAATATCTGAAAACCCACGTGCGCAATTCGCACGTCTGCAAGTA
CTGCACCACCGCCTTCGCCAAGGTTCGCGATCTCAATGAGCATATTCGGC
AGAAGCATCCGCATCACCAGTGCGTTGTCTGCTCCAACAACTTTAGTACC
AGTAGCAATCTGAGGGCTCACTTAAAGAAAATTCATGGAGTTCAGCTGCC
CGCACAGGTGGCACTGCTGGATTACAGGCCAGCCAGTCAGGATCGGGATA
ATCCGCGCTCATAATAAAGATTATATTACATAGTTAAAAAAAAAAAAAAA
AA

RH12261.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 1128 CG13123-RA 45..1128 2..1085 5420 100 Plus
CG13123.a 1078 CG13123.a 2..1078 2..1085 5290 99.3 Plus
CG13123.b 996 CG13123.b 45..996 134..1085 4760 100 Plus
CG13123.b 996 CG13123.b 11..44 2..35 170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9790803..9791664 1085..218 4215 99.3 Minus
chr2L 23010047 chr2L 9791717..9791933 218..2 1055 99.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 972 CG13123-PA 1..972 93..1064 4860 100 Plus
CG13123-RC 813 CG13123-PC 1..813 252..1064 4065 100 Plus
CG13123-RB 813 CG13123-PB 1..813 252..1064 4065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 1094 CG13123-RA 11..1094 2..1085 5420 100 Plus
CG13123-RC 1087 CG13123-RC 11..1087 2..1085 5280 99.4 Plus
CG13123-RB 996 CG13123-RB 45..996 134..1085 4760 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 323 CG13123-PA 1..323 93..1061 1629 100 Plus
CG13123-PC 270 CG13123-PC 1..270 252..1061 1356 100 Plus
CG13123-PB 270 CG13123-PB 1..270 252..1061 1356 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9791960..9792828 1086..218 4345 100 Minus
2L 23513712 2L 9792881..9793097 218..2 1085 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9791960..9792828 1086..218 4345 100 Minus
2L 23513712 2L 9792881..9793097 218..2 1085 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:27:38 has no hits.

RH12261.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:22:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9791717..9791933 1..218 98   Minus
chr2L 9790803..9791663 219..1085 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:27 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 93..1064 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 93..1064 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:40:53 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 93..1064 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:35 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 93..1064 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:22:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 93..1064 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:02 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..1083 2..1084 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..1084 2..1085 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:40:53 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 10..1094 1..1085 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:35 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..1083 2..1084 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 10..1094 1..1085 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:06 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9792881..9793097 1..218 99   Minus
2L 9791961..9792827 219..1085 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:40:53 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9792881..9793097 1..218 99   Minus
arm_2L 9791961..9792827 219..1085 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:26 Download gff for RH12261.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9792881..9793097 1..218 99   Minus
2L 9791961..9792827 219..1085 100 <- Minus

RH12261.pep Sequence

Translation from 92 to 1063

> RH12261.pep
MDLRKLCRICFVDSASVDIREHRSGGSSDQTVLQLIEAMFGWNIALNLTE
ELPMICNDCLEDCLQQYAFFRKLTFANQQLLQLYNEAEVEMCQVKMDATE
EEPENQASDEFEILEEFRRIPLDYVVLDPDRPTETRQTRRRTDSCTKPSQ
RLANQDSLIVSEFLPATTAQPRLDLSDSQLEQLESPAYEMRTVDYAAVEL
KHYNLDEYNEANRLLDVEPSGSQAIYKCQYCPLAYASPQYLKTHVRNSHV
CKYCTTAFAKVRDLNEHIRQKHPHHQCVVCSNNFSTSSNLRAHLKKIHGV
QLPAQVALLDYRPASQDRDNPRS*

RH12261.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21873-PA 309 GF21873-PA 1..307 1..322 1072 66.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24005-PA 321 GG24005-PA 1..321 1..323 1465 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13057-PA 328 GH13057-PA 3..321 1..317 866 55.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 323 CG13123-PA 1..323 1..323 1703 100 Plus
CG13123-PC 270 CG13123-PC 1..270 54..323 1430 100 Plus
CG13123-PB 270 CG13123-PB 1..270 54..323 1430 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18201-PA 342 GI18201-PA 3..332 1..318 892 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19207-PA 346 GL19207-PA 1..345 1..321 822 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12061-PA 346 GA12061-PA 1..345 1..321 829 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12244-PA 321 GM12244-PA 1..321 1..323 1611 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22334-PA 321 GD22334-PA 1..321 1..323 1646 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14699-PA 320 GJ14699-PA 3..315 1..323 883 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24145-PA 295 GK24145-PA 1..291 1..317 673 46.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10303-PA 321 GE10303-PA 1..321 1..323 1532 88.9 Plus

RH12261.hyp Sequence

Translation from 92 to 1063

> RH12261.hyp
MDLRKLCRICFVDSASVDIREHRSGGSSDQTVLQLIEAMFGWNIALNLTE
ELPMICNDCLEDCLQQYAFFRKLTFANQQLLQLYNEAEVEMCQVKMDATE
EEPENQASDEFEILEEFRRIPLDYVVLDPDRPTETRQTRRRTDSCTKPSQ
RLANQDSLIVSEFLPATTAQPRLDLSDSQLEQLESPAYEMRTVDYAAVEL
KHYNLDEYNEANRLLDVEPSGSQAIYKCQYCPLAYASPQYLKTHVRNSHV
CKYCTTAFAKVRDLNEHIRQKHPHHQCVVCSNNFSTSSNLRAHLKKIHGV
QLPAQVALLDYRPASQDRDNPRS*

RH12261.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 323 CG13123-PA 1..323 1..323 1703 100 Plus
CG13123-PC 270 CG13123-PC 1..270 54..323 1430 100 Plus
CG13123-PB 270 CG13123-PB 1..270 54..323 1430 100 Plus