Clone RH13862 Report

Search the DGRC for RH13862

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:138
Well:62
Vector:pFlc-1
Associated Gene/TranscriptUev1A-RB
Protein status:RH13862.pep: gold
Preliminary Size:888
Sequenced Size:1120

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10640 2002-10-18 Blastp of sequenced clone
Uev1A 2008-04-29 Release 5.5 accounting
Uev1A 2008-08-15 Release 5.9 accounting
Uev1A 2008-12-18 5.12 accounting

Clone Sequence Records

RH13862.complete Sequence

1120 bp (1120 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001776

> RH13862.complete
GGCAGTGGTGCCACGGAATTTCCGCTTACTGGAGGAGCTGGATCAGGGCC
AGAAGGGCGTGGGCGATGGCACCATATCGTGGGGCCTGGAGAACGACGAC
GACATGACGCTCACCTACTGGATCGGCATGATCATCGGTCCGCCTAGAAC
ACCATTCGAGAATCGAATGTATTCACTAAAGATCGAGTGCGGCGAACGCT
ATCCGGATGAGCCACCAACGCTCCGGTTTATAACTAAAGTAAACATTAAC
TGCATTAATCAGAACAATGGCGTGGTTGATCATAGATCAGTTCAGATGTT
GGCCAGATGGAGTCGCGAGTACAATATAAAAACGATGCTGCAGGAAATCC
GTAGGATTATGACCATGAAAGAGAACCTGAAGCTGGCACAGCCGCCAGAA
GGTAGCTGTTTTTAGTCGACAACATCCGTTAGCAACACCAGCAGCAGCTG
CAACAGCATCGAATGCAACGCGAGCGGGAGCAGCATCCACACCCAGTAAG
AGCCGGAAAACGAACCACCATCATCAGTCCAAAAGTCCAAGACCAAGGTG
GCCACACGTGCGTGGAATTAAAAAGAGATTGTGTGGCGGCTGCTCCGCCG
AGTTGCCATCGGTGGCAGCGTATGCTTATTAATGAACGTAATAAAGATCG
AGTGCGGTTATTGTGGCAAGAACAACAACCAAATGCAAGCTATATACTAT
AAGTAAAGGGAACAGCAGCGAAAAATGCGATAGGAGCGTCACTATGAAGA
GGTCGTCGTCGTCCCTTCCGTCATGAACTATGTCATCGTGTTTGGTTACC
TTACTCTTCTTACTACTTCAACTTCAGTCCCCAAACAAAACGAAACGAAA
ATATGAGAACTTCTTTTGAATAAGAAATAAAACAGCAGCAAAAGAAACAA
GTTAAATGCCTGAATGTTTCAGATTCAAAACTTCAAATCGAAAATTCGTA
AACTAATCGAACAGAAAAGTAATGCATAACAATGATAACGATTAATCAAG
ATCACAGCGTGAGATCCGAGCGTAATTATTGTTTTTTTTTGCCTAAACTA
AAAATTTATTAATTATATACATAAAGCAAAATATATATTAATTTAAATAA
AACCAAAAAAAAAAAAAAAA

RH13862.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-RB 1452 Uev1A-RB 168..1272 2..1106 5525 100 Plus
Uev1A-RA 1565 Uev1A-RA 190..1291 5..1106 5510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5355763..5356592 1104..274 4060 99.5 Minus
chr3L 24539361 chr3L 5357516..5357662 148..2 735 100 Minus
chr3L 24539361 chr3L 5356658..5356785 276..149 640 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-RC 438 CG10640-PC 28..438 5..415 2055 100 Plus
Uev1A-RA 438 CG10640-PA 28..438 5..415 2055 100 Plus
Uev1A-RB 312 CG10640-PB 1..312 104..415 1560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-RC 1189 CG10640-RC 54..1153 5..1104 5500 100 Plus
Uev1A-RB 1609 CG10640-RB 208..1307 5..1104 5500 100 Plus
Uev1A-RA 1196 CG10640-RA 97..1196 5..1104 5500 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-PC 145 CG10640-PC 10..142 5..403 715 100 Plus
Uev1A-PA 145 CG10640-PA 10..142 5..403 715 100 Plus
Uev1A-PB 103 CG10640-PB 1..100 104..403 538 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5363184..5364016 1106..274 4165 100 Minus
3L 28110227 3L 5364943..5365089 148..2 735 100 Minus
3L 28110227 3L 5364082..5364209 276..149 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5356284..5357116 1106..274 4165 100 Minus
3L 28103327 3L 5358043..5358189 148..2 735 100 Minus
3L 28103327 3L 5357182..5357309 276..149 640 100 Minus
Blast to na_te.dros performed 2014-11-27 00:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6842..6954 417..529 123 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1535..1578 416..460 114 75.6 Plus
Ddip\Bari1 1677 Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. 1334..1592 1093..842 114 55.3 Minus

RH13862.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:37:35 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5357516..5357662 1..148 99   Minus
chr3L 5356660..5356785 149..274 100 <- Minus
chr3L 5355816..5356591 275..1050 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:44 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 22..438 1..415 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:10:12 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 22..438 1..415 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:33 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 22..438 1..415 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:04 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 22..438 1..415 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:35 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 22..438 1..415 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:31:23 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RB 1..1103 2..1104 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:10:12 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RB 1..1103 2..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:33 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 91..1196 1..1104 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:04 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RB 1..1103 2..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:35 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 91..1196 1..1104 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:37:35 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5364943..5365089 1..148 99   Minus
3L 5364084..5364209 149..274 100 <- Minus
3L 5363186..5364015 275..1104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:33 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5358043..5358189 1..148 99   Minus
arm_3L 5357184..5357309 149..274 100 <- Minus
arm_3L 5356286..5357115 275..1104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:32:39 Download gff for RH13862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5358043..5358189 1..148 99   Minus
3L 5357184..5357309 149..274 100 <- Minus
3L 5356286..5357115 275..1104 100 <- Minus

RH13862.hyp Sequence

Translation from 0 to 414

> RH13862.hyp
AVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRT
PFENRMYSLKIECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQML
ARWSREYNIKTMLQEIRRIMTMKENLKLAQPPEGSCF*

RH13862.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-PC 145 CG10640-PC 10..145 2..137 734 100 Plus
Uev1A-PA 145 CG10640-PA 10..145 2..137 734 100 Plus
Uev1A-PB 103 CG10640-PB 1..103 35..137 557 100 Plus
Ubc6-PC 151 CG2013-PC 30..114 34..121 140 33.7 Plus
Ubc6-PA 151 CG2013-PA 30..114 34..121 140 33.7 Plus

RH13862.pep Sequence

Translation from 103 to 414

> RH13862.pep
MTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKVNINC
INQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQPPEG
SCF*

RH13862.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 02:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10466-PA 145 GF10466-PA 43..145 1..103 539 97.1 Plus
Dana\GF16080-PA 151 GF16080-PA 36..114 6..87 144 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 02:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14135-PA 145 GG14135-PA 43..145 1..103 554 100 Plus
Dere\GG11277-PA 151 GG11277-PA 36..114 6..87 144 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 02:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15269-PA 145 GH15269-PA 43..145 1..103 538 97.1 Plus
Dgri\GH15302-PA 151 GH15302-PA 36..114 6..87 144 34.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-PB 103 CG10640-PB 1..103 1..103 557 100 Plus
Uev1A-PC 145 CG10640-PC 43..145 1..103 557 100 Plus
Uev1A-PA 145 CG10640-PA 43..145 1..103 557 100 Plus
Ubc6-PC 151 CG2013-PC 36..114 6..87 136 34.9 Plus
Ubc6-PA 151 CG2013-PA 36..114 6..87 136 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 02:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11977-PA 145 GI11977-PA 43..145 1..103 535 96.1 Plus
Dmoj\GI22506-PA 151 GI22506-PA 36..114 6..87 144 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 02:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12148-PA 145 GL12148-PA 43..145 1..103 529 95.1 Plus
Dper\GL24789-PA 85 GL24789-PA 43..82 1..40 211 95 Plus
Dper\GL22213-PA 151 GL22213-PA 36..114 6..87 144 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 02:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10461-PA 145 GA10461-PA 43..145 1..103 529 95.1 Plus
Dpse\GA15184-PB 118 GA15184-PB 3..81 6..87 145 34.9 Plus
Dpse\GA15184-PA 151 GA15184-PA 36..114 6..87 144 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 02:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13922-PA 145 GM13922-PA 43..145 1..103 554 100 Plus
Dsec\GM10669-PA 151 GM10669-PA 36..114 6..87 144 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 02:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13202-PA 145 GD13202-PA 43..145 1..103 554 100 Plus
Dsim\GD19645-PA 151 GD19645-PA 36..114 6..87 144 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 02:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12202-PA 145 GJ12202-PA 43..145 1..103 535 96.1 Plus
Dvir\GJ10109-PA 151 GJ10109-PA 36..114 6..87 144 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 02:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17319-PA 147 GK17319-PA 45..147 1..103 534 96.1 Plus
Dwil\GK14053-PA 151 GK14053-PA 36..114 6..87 144 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 02:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Uev1A-PA 145 GE20564-PA 43..145 1..103 554 100 Plus
Dyak\GE25319-PA 151 GE25319-PA 36..114 6..87 144 34.9 Plus