Clone RH14316 Report

Search the DGRC for RH14316

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:143
Well:16
Vector:pFlc-1
Associated Gene/TranscriptPu-RC
Protein status:RH14316.pep: gold
Sequenced Size:1755

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pu-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RH14316.complete Sequence

1755 bp assembled on 2010-12-09

GenBank Submission: BT125829.1

> RH14316.complete
GACCAGAAGAGCAGAGCCACCCGAAGCGCCAACACGCGAAGACAAAGTCC
GGCAGACAGCAGCGCAAAAAGAGACAGATAGCAGTGAGAAAATCATCGAG
GAAAAAAGATTGTGTGCTAGCCGTCAAATTGAGTTCCATTCGAGTGGCAA
ACAAACCTGAGTAGCCGCACCGCCATGAGCTTTACCCGCCAACTGTCCGA
GATGAGTGCCAGCGAGCTGAACGATGCCATCGACGACACCAACTTCCCGC
AGGCCCACATCCTTTCGCGCGGACGCAACAACAGCGTCTGCTCAACAAGT
AGCACCTCGGGCACCTCCTCGCTGGCGGACAGGCAGCAGAACCAGGCGGA
GGAGGCCACTGCCATTGCGGGCACACCCGTCGAGGAGGTGGCGCCAGCTC
CTGCTCTCGTCCCGTTGGCCGGCAACCAGAGACCCCGCCTCATCCTGAAG
ACCAACGGCAGCAGTCCGGATAGTGATGGCCACGAGAAGTGCACGTTCCA
CCACGACCTGGAGCTGGACCACAAGCCGCCGACGCGAGAGGCCCTCCTTC
CGGACATGGCACGCTCGTATCGTCTACTCTTGGGCGGCCTGGGCGAGAAT
CCCGATCGCCAGGGACTGATCAAGACGCCGGAGCGGGCAGCCAAGGCCAT
GCTGTACTTCACCAAGGGCTACGACCAGAGTCTCGAGGATGTTCTCAATG
GCGCCGTTTTCGACGAGGATCATGACGAAATGGTGGTGGTCAAGGATATT
GAAATGTTCTCCATGTGCGAGCATCATCTGGTGCCCTTCTACGGCAAAGT
TTCCATCGGTTATTTGCCGTGCAACAAGATTCTCGGACTCAGTAAATTGG
CACGCATTGTCGAAATATTTTCGCGTCGCCTGCAAGTCCAGGAGCGCTTA
ACTAAGCAGATCGCAGTGGCCGTGACTCAGGCCGTGCAACCCGCTGGAGT
AGCAGTGGTCGTAGAGGGAGTCCACATGTGCATGGTGATGCGTGGCGTGC
AGAAGATCAACAGCAAAACTGTTACCTCAACTATGCTGGGCGTGTTCCGA
GACGATCCCAAGACCCGTGAGGAATTCCTGAACTTAGTCAATAGCAAATA
GAGTGGGCACTAGAGGACGCTACTGAAATCCGAGACCAACTAAACCCCTA
CAATATTGGAGGCGCTTATATACAAACAAACAAAAATGAAACGAAACACA
GGGTCCATTAGTTTATGTTTTTAGGATTGATTTCATTTAGTTAGTGCAAT
GATTGCGCAGCCATTTTCCTTGTTGATTTGTGTAAAAATTGTTGAAAAAT
TTTGTTAGCAAAATACGTTTTTTAGATAGATGAATGTAATGAGAAGCGAG
ATTCGAAGAGGACGAGATTTGAATACCGGTGTTGGGTAGTTTTATGTTCA
ATTTTATATGCAGTTTTATGGCACTTGAACGATAATTTTTACAACGTATA
CATACGATTAATGCATTGTGCAATAAGGGAACAACTGATAATAAATCACG
GCAAATTGTTTAGGGAATTTACAATTTATAAACAGTTCACATCAAATTAA
TCAGATCTATAGTTATGTATGTATGTTAACCTATATAAAGAGTTGCATTC
ATAATGTTCCTCGACAGGGACCAAAGTATATTGGAAGATTTTAAATGTTA
AAATTATATGCTCATTATGTAAATGACGTTGCTTGTAGTGAGTCAAAGCT
GCTTATTAATTATACAATAAATTATGTATTTAAATAACGAAAAAAAAAAA
AAAAA

RH14316.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17068294..17069063 972..1739 3680 99.1 Plus
chr2R 21145070 chr2R 17065582..17066059 2..479 2285 98.5 Plus
chr2R 21145070 chr2R 17066400..17066610 478..688 1055 100 Plus
chr2R 21145070 chr2R 17067877..17068043 688..854 835 100 Plus
chr2R 21145070 chr2R 17068102..17068219 854..971 575 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RC 927 CG9441-PC 1..927 175..1101 4635 100 Plus
Pu-RA 975 CG9441-PA 352..975 478..1101 3120 100 Plus
Pu-RB 822 CG9441-PB 199..822 478..1101 3120 100 Plus
Pu-RA 975 CG9441-PA 1..305 175..479 1525 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RC 1744 CG9441-RC 2..1742 2..1739 8625 99.8 Plus
Pu-RA 1793 CG9441-RA 527..1791 478..1739 6245 99.8 Plus
Pu-RB 1625 CG9441-RB 359..1623 478..1739 6245 99.8 Plus
Pu-RA 1793 CG9441-RA 3..480 2..479 2390 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PC 308 CG9441-PC 1..308 175..1098 1318 100 Plus
Pu-PA 324 CG9441-PA 1..324 175..1098 1291 95.1 Plus
Pu-PB 273 CG9441-PB 59..273 439..1098 964 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21181836..21182606 972..1739 3775 99.6 Plus
2R 25286936 2R 21179120..21179597 2..479 2390 100 Plus
2R 25286936 2R 21179937..21180147 478..688 1055 100 Plus
2R 25286936 2R 21181419..21181585 688..854 835 100 Plus
2R 25286936 2R 21181644..21181761 854..971 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21183035..21183805 972..1739 3785 99.6 Plus
2R 25260384 2R 21180319..21180796 2..479 2390 100 Plus
2R 25260384 2R 21181136..21181346 478..688 1055 100 Plus
2R 25260384 2R 21182618..21182784 688..854 835 100 Plus
2R 25260384 2R 21182843..21182960 854..971 590 100 Plus
Blast to na_te.dros performed 2014-11-27 16:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6193..6244 1142..1192 122 73.1 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1525..1598 1128..1202 120 64 Plus

RH14316.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:48 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17068294..17069024 972..1700 99 -> Plus
chr2R 17068103..17068219 855..971 99 -> Plus
chr2R 17067878..17068043 689..854 100 -> Plus
chr2R 17066401..17066610 479..688 100 -> Plus
chr2R 17065581..17066058 1..478 98 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:21 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 1..927 175..1101 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:22 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 1..927 175..1101 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:48 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 1..927 175..1101 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:21 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 2..1742 2..1739 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:22 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 2..1742 2..1739 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:48 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RC 2..1742 2..1739 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:48 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21181836..21182606 972..1739 99   Plus
2R 21181645..21181761 855..971 100 -> Plus
2R 21181420..21181585 689..854 100 -> Plus
2R 21179938..21180147 479..688 100 -> Plus
2R 21179119..21179596 1..478 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:22 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17069341..17070111 972..1739 99   Plus
arm_2R 17069150..17069266 855..971 100 -> Plus
arm_2R 17068925..17069090 689..854 100 -> Plus
arm_2R 17067443..17067652 479..688 100 -> Plus
arm_2R 17066624..17067101 1..478 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:30 Download gff for RH14316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21183035..21183805 972..1739 99   Plus
2R 21182844..21182960 855..971 100 -> Plus
2R 21182619..21182784 689..854 100 -> Plus
2R 21181137..21181346 479..688 100 -> Plus
2R 21180318..21180795 1..478 99 -> Plus

RH14316.pep Sequence

Translation from 174 to 1100

> RH14316.pep
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSL
ADRQQNQAEEATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDS
DGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIK
TPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEH
HLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAV
TQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREE
FLNLVNSK*

RH14316.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11941-PA 285 GF11941-PA 73..285 91..308 1070 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22097-PA 271 GG22097-PA 18..271 58..308 1087 85.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20729-PA 337 GH20729-PA 1..337 1..308 1262 80.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PC 308 CG9441-PC 1..308 1..308 1573 100 Plus
Pu-PA 324 CG9441-PA 1..324 1..308 1546 95.1 Plus
Pu-PB 273 CG9441-PB 18..273 58..308 1088 85.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20812-PA 274 GI20812-PA 65..274 99..308 1059 97.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10161-PA 274 GL10161-PA 42..274 77..308 1064 91 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30270-PB 325 GA30270-PB 1..325 1..308 1343 85.5 Plus
Dpse\GA30270-PA 277 GA30270-PA 42..277 77..308 1056 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15814-PA 273 GM15814-PA 18..273 58..308 1088 85.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11572-PA 273 GD11572-PA 18..273 58..308 1088 85.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20545-PA 270 GJ20545-PA 42..270 77..308 1062 90.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21906-PA 321 GK21906-PA 1..321 1..308 1316 82.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12177-PA 271 GE12177-PA 18..271 58..308 1084 85 Plus

RH14316.hyp Sequence

Translation from 174 to 1100

> RH14316.hyp
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSL
ADRQQNQAEEATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDS
DGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIK
TPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEH
HLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAV
TQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREE
FLNLVNSK*

RH14316.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PC 308 CG9441-PC 1..308 1..308 1573 100 Plus
Pu-PA 324 CG9441-PA 1..324 1..308 1546 95.1 Plus
Pu-PB 273 CG9441-PB 18..273 58..308 1088 85.2 Plus