Clone RH18934 Report

Search the DGRC for RH18934

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:189
Well:34
Vector:pFlc-1
Associated Gene/TranscriptCG5038-RA
Protein status:RH18934.pep: gold
Preliminary Size:2577
Sequenced Size:2744

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5038 2002-01-01 Sim4 clustering to Release 2
CG5038 2003-01-01 Sim4 clustering to Release 3
CG5038 2005-05-17 Blastp of sequenced clone
CG5038 2008-04-29 Release 5.5 accounting
CG5038 2008-08-15 Release 5.9 accounting
CG5038 2008-12-18 5.12 accounting

Clone Sequence Records

RH18934.complete Sequence

2744 bp (2744 high quality bases) assembled on 2005-05-17

GenBank Submission: BT022723

> RH18934.complete
GACTATTCAGTGAGGGGGTGTTTGGACAAAAACACAACAAAAAATGTATA
CAAAACAATTCCGATTAAAATTCGCAGAATAAGTGAATTAAACTTGAACA
ATTGACAATTAGTAAATAATCCAGTATGCTAGACCTCGTTCACAAAGCCA
CGCTGCATAGCATGGTCTGTCAGGCAATCCTAGTGTTAATCTGTTTGCTA
TGCTACGGATGCGGTGGCCTCAGTGGAGCGAAGTTTGTCTTCGATGATAC
GGTGGCCATCGTCAAGAACCGGGATGTCAACTCACTGCCCACCAACTGGA
CGGCGATCTTCACGCACGACTTCTGGGGTGCTTCCTTGCTCAGTTCCGAT
TCCCACAAATCATTTCGGCCACTGACCACCCTGATGTTCCATTGCGAGTA
TGCCCTTCTGGGGCTAAGTGCCGCCCACATGAAGTTCCTAAACCTCCTGC
TACACTGCGTCAACACGCTGCTCATGTGGCGATTGATTCGCTCTCTCTAT
GTTCCGGAGGTCAGCACGGCAAGATGGGCCATCCTCTCCGCTGCTCTATT
TGCCGCCCATCCAATTCACACAGAGGCGGTTTCTGGTGTGGTTGGAAGGG
CCGAGCTCATGTTCGGCATGATTCACTTGTTGTGTCTTCTGCTGACCGTG
GCCAATACCGGAAGACTTGGTCCACAGACTGGCGGTCTAATCATGCTGCT
CACCGCTGTGGGAATGCTGTTCAAGGAGTCCGCTGTGACCATCCCCATGT
CGTGTGTACTATTGGATTACTTTCAAAACGGCTACTATCATCTGCGATTC
AAGGATCAGTGGAGTCTTTTGCGCACCCGGATCAGCTACTTGTTCTACTT
GCTGGGTACCTTGGGTCTGCTGACGGCTCGCCTTTGGTGGCAGGACTTTG
AGACGCCTACCTTCAAGGAAGTTGACAACCCCGTTGCGCACAATGAGCAC
GTGCTGACCCGTGGGCTCTCCCAGCAGTATCTGCTGGTCATGAACATCTG
GCTGATGCTGTGCCCCCACTGGCTATGCTACGACTGGGCATTGGGTTGCG
TCAAGTTGGTGACCAACATCTGGGATCTGAGACTGCAGGGCGTCATCGGA
TTCTACTCCATCGTATTGGTGGCTCTGATGAACTTCCGACGGCTGCCCGG
AATGATGTTAGCTCTGGGTTTAATGATCGTCCCGTTCCTGCCCGCGTCGG
GAATCATTTGCGTAGGATTCGTGATTGCCGAACGGACGCTCTATGTACCC
TCCATTGGCTTTTGCCTGCTGTCCATCTATGGATTCTTATATTGGTATGA
CAGCAGTACGGAAAACACCCACTGGCGCACTGCTCTACGGATTCTTTTAA
TGCTGCTCTTTTCGGTTATGATGGTACGGACTCGGCAGCGAGCTACTGAC
TGGCTTAACGAGGAGCAGTTGTTCAAGTCCGCGCTACAGGTGTGTCCTGA
CAATGCCAAGGTACACTATAACATAGCCCGACTGGCCACTGATATGGGAA
ACAATACGAAAGCCTTTCAGCACTACCACAGGGCCATTGAATTGTATCCG
AACTATGAGTCAGCTCTTATGAACCTCGGCAACCTGTATCGGGAGCACGG
TCAACTATCCACCGCCGAGGAATACATTCGATTGGCTTTGCAGGCGTATC
CCGCATTTCCAGCGGCTTGGATGAATCTCGGCATTGTGCAGTCGGCTCAG
GGAAAGTACGACAAGGCTCTGGCCAGCTATGAGAAGGCCCTGAAGTACAG
AGCCAATTTCGCCGTCTGCTACTACAACATGGGCAATCTGTATCTGGAGC
AGAAACGTTACGCCGAAGCGCTTCATCATTGGCAGCATGCTGTGGCACTA
AATCCCCGCCAGCCAAAAGCCTGGGCTAACATTCTGACAATGCTGGACAA
CAAGGGGTTGCAGGATGACGCCTTGCGCATCTCTAATCAGGCTCTCCAAC
ATCTACCCAACGATGTCAGTATCCTTTTCATTCGAGCAAACGTGCTTGGC
AAATTAAAACATTATACGGAGGCGGAGGCGATCTACAAGCGCGTTATTGA
GCTGGAGCCCCACAACACATTGTACCACACGAATCTCGGAGTTCTCTATC
ATCGCTGGGACAAGACGCAGGAGGCTATAGAGGCTTATCGAACTGCAATA
AGTATTAGTGCGGCTAGAGCAACGACAGCCCGGGAGAATCTCAGCAAGCT
CTTAAAACGCCTGGAAAGGGAGGCGCAAGTCATGCAGAGATAAGCGTTTC
AAGTCCCACCATCCAAATATGGATCCAACCAAAATCTTGGTTGTTTGCAA
ATAATAAGAGGTATGTACACTTCGCAAGCTGTAATAATCCCAAACGAAAG
ACGAGGTTGTGGGTTAAATTACTTATTCATAAAAGACATTAAAACTAGTT
AGTCTAATTTAATTTTAATTCCGTGCAATATTGTATCTATATCATACATT
CATATCCCATCAGCTAAAATCTCATGACACCCTAATTGTATTTAGTATAA
GTTAGGATAGTTTATTCATTTACTCGAGGGTATATACAATTAATGTTAAA
ACTAAATAATGATCGAACAATTACAAGACGACTTACATAATTTAACTAAA
CTCTAGAACTAAGCGCTACATGAAATACTTCAAAGAATAGTGACAATTGT
GGCACCATTGTAAAATAATTCAATTCCATTAAAGATTCATGATTTTAAAA
TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH18934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-RA 2700 CG5038-RA 1..2700 2..2701 13485 99.9 Plus
CG6194-RA 2839 CG6194-RA 2555..2839 2703..2419 1425 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11175862..11178561 2..2701 13470 99.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-RA 2118 CG5038-PA 1..2118 126..2243 10575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-RA 2702 CG5038-RA 3..2702 2..2701 13485 100 Plus
Atg4b-RA 2665 CG6194-RA 2459..2665 2701..2495 1035 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-PA 705 CG5038-PA 1..705 126..2240 3385 100 Plus
CG4050-PB 926 CG4050-PB 57..766 237..2057 579 29.4 Plus
CG4050-PA 926 CG4050-PA 57..766 237..2057 579 29.4 Plus
CG4341-PC 908 CG4341-PC 21..313 225..1118 348 35.3 Plus
CG4341-PA 938 CG4341-PA 51..343 225..1118 348 35.3 Plus
CG4341-PC 908 CG4341-PC 475..826 1152..2270 335 26.6 Plus
CG4050-PB 926 CG4050-PB 617..849 1413..2099 202 24.8 Plus
CG4050-PA 926 CG4050-PA 617..849 1413..2099 202 24.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15351227..15353928 2..2703 13495 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15092058..15094759 2..2703 13495 99.9 Plus
Blast to na_te.dros performed on 2014-11-27 08:56:38 has no hits.

RH18934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:12:57 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11175861..11178561 1..2701 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:52 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2118 126..2243 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:22 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2118 126..2243 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:12 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2118 126..2243 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:22 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2118 126..2243 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:57 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2118 126..2243 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:30:31 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 2..2701 2..2701 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:21 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 1..2700 2..2701 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:12 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 2..2702 1..2701 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:22 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 2..2701 2..2701 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:57 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
CG5038-RA 2..2702 1..2701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:57 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15351226..15353926 1..2701 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:12 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11176948..11179648 1..2701 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:57 Download gff for RH18934.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15092057..15094757 1..2701 99   Plus

RH18934.pep Sequence

Translation from 125 to 2242

> RH18934.pep
MLDLVHKATLHSMVCQAILVLICLLCYGCGGLSGAKFVFDDTVAIVKNRD
VNSLPTNWTAIFTHDFWGASLLSSDSHKSFRPLTTLMFHCEYALLGLSAA
HMKFLNLLLHCVNTLLMWRLIRSLYVPEVSTARWAILSAALFAAHPIHTE
AVSGVVGRAELMFGMIHLLCLLLTVANTGRLGPQTGGLIMLLTAVGMLFK
ESAVTIPMSCVLLDYFQNGYYHLRFKDQWSLLRTRISYLFYLLGTLGLLT
ARLWWQDFETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWL
CYDWALGCVKLVTNIWDLRLQGVIGFYSIVLVALMNFRRLPGMMLALGLM
IVPFLPASGIICVGFVIAERTLYVPSIGFCLLSIYGFLYWYDSSTENTHW
RTALRILLMLLFSVMMVRTRQRATDWLNEEQLFKSALQVCPDNAKVHYNI
ARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEY
IRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYY
NMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDAL
RISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLY
HTNLGVLYHRWDKTQEAIEAYRTAISISAARATTARENLSKLLKRLEREA
QVMQR*

RH18934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22999-PA 705 GF22999-PA 1..702 1..702 3171 83.2 Plus
Dana\GF12977-PA 930 GF12977-PA 46..771 22..645 582 30.1 Plus
Dana\GF13886-PA 853 GF13886-PA 15..755 28..668 546 27.4 Plus
Dana\GF15075-PA 914 GF15075-PA 22..323 35..340 364 37 Plus
Dana\GF15075-PA 914 GF15075-PA 481..909 343..692 328 26.6 Plus
Dana\GF13981-PA 396 GF13981-PA 92..319 444..678 212 28.5 Plus
Dana\GF12977-PA 930 GF12977-PA 655..853 430..658 165 24.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16920-PA 705 GG16920-PA 1..705 1..705 3630 96.7 Plus
Dere\GG20802-PA 928 GG20802-PA 42..769 19..679 572 28.9 Plus
Dere\GG24759-PA 944 GG24759-PA 48..352 34..342 416 38.8 Plus
Dere\GG24876-PA 851 GG24876-PA 31..334 28..335 345 35.1 Plus
Dere\GG24759-PA 944 GG24759-PA 511..939 343..692 344 26.6 Plus
Dere\GG24876-PA 851 GG24876-PA 411..846 344..695 274 25.5 Plus
Dere\GG20802-PA 928 GG20802-PA 619..890 430..698 177 24.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16619-PA 701 GH16619-PA 6..699 8..701 2693 72.6 Plus
Dgri\GH21177-PA 956 GH21177-PA 71..799 19..644 587 28.9 Plus
Dgri\GH11255-PA 987 GH11255-PA 67..358 35..331 354 35.6 Plus
Dgri\GH11163-PA 853 GH11163-PA 11..336 28..340 345 34.1 Plus
Dgri\GH11255-PA 987 GH11255-PA 544..982 338..692 315 27.6 Plus
Dgri\GH11163-PA 853 GH11163-PA 413..845 342..692 305 26.4 Plus
Dgri\GH21711-PA 1053 GH21711-PA 167..439 431..704 262 29.9 Plus
Dgri\GH21177-PA 956 GH21177-PA 684..882 430..658 165 25.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-PA 705 CG5038-PA 1..705 1..705 3713 100 Plus
CG4050-PB 926 CG4050-PB 40..785 19..698 673 28.9 Plus
CG4050-PA 926 CG4050-PA 40..785 19..698 673 28.9 Plus
CG4341-PC 908 CG4341-PC 21..313 34..331 407 37.4 Plus
CG4341-PA 938 CG4341-PA 51..343 34..331 407 37.4 Plus
CG4341-PC 908 CG4341-PC 475..903 343..692 341 25.9 Plus
CG4050-PB 926 CG4050-PB 617..888 430..698 209 24.1 Plus
CG4050-PA 926 CG4050-PA 617..888 430..698 209 24.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22034-PA 708 GI22034-PA 4..701 2..699 2801 76.2 Plus
Dmoj\GI18771-PA 930 GI18771-PA 45..770 19..644 608 29.2 Plus
Dmoj\GI21878-PA 943 GI21878-PA 22..313 35..331 351 34.6 Plus
Dmoj\GI21878-PA 943 GI21878-PA 509..938 343..692 327 27.5 Plus
Dmoj\GI17875-PA 851 GI17875-PA 26..315 35..332 315 35.5 Plus
Dmoj\GI17875-PA 851 GI17875-PA 410..843 343..692 303 26.5 Plus
Dmoj\GI18858-PA 1052 GI18858-PA 157..437 423..704 270 30.1 Plus
Dmoj\GI18771-PA 930 GI18771-PA 621..853 430..658 169 24.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13726-PA 710 GL13726-PA 9..710 4..705 3273 85 Plus
Dper\GL10177-PA 921 GL10177-PA 50..760 19..644 509 29.4 Plus
Dper\GL26575-PA 833 GL26575-PA 48..355 28..340 334 33.6 Plus
Dper\GL16428-PA 1006 GL16428-PA 572..891 343..683 322 27.4 Plus
Dper\GL16428-PA 1006 GL16428-PA 108..400 35..340 322 34.6 Plus
Dper\GL26575-PA 833 GL26575-PA 423..830 344..697 312 26.6 Plus
Dper\GL13214-PA 881 GL13214-PA 99..306 436..677 251 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18614-PA 707 GA18614-PA 6..707 4..705 3262 84.8 Plus
Dpse\GA17918-PA 933 GA17918-PA 50..773 19..679 569 29.7 Plus
Dpse\GA18121-PA 961 GA18121-PA 54..355 35..340 357 36.2 Plus
Dpse\GA16399-PA 845 GA16399-PA 26..340 28..340 330 33.7 Plus
Dpse\GA18121-PA 961 GA18121-PA 527..846 343..683 322 27.4 Plus
Dpse\GA16399-PA 845 GA16399-PA 408..842 344..697 306 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24226-PA 705 GM24226-PA 1..705 1..705 3727 98.3 Plus
Dsec\GM18357-PA 881 GM18357-PA 47..873 28..692 575 26.7 Plus
Dsec\GM15749-PA 926 GM15749-PA 40..767 19..679 575 29.1 Plus
Dsec\GM16782-PA 577 GM16782-PA 144..462 343..683 335 27.8 Plus
Dsec\GM16781-PA 292 GM16781-PA 51..237 34..218 301 42.9 Plus
Dsec\GM15749-PA 926 GM15749-PA 617..888 430..698 178 24.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19017-PA 705 GD19017-PA 1..705 1..705 3755 99 Plus
Dsim\GD25224-PA 926 GD25224-PA 40..767 19..679 571 29 Plus
Dsim\GD23172-PA 1362 GD23172-PA 47..738 28..704 425 24.7 Plus
Dsim\GD23061-PA 759 GD23061-PA 326..645 343..684 342 27.7 Plus
Dsim\GD25224-PA 926 GD25224-PA 617..888 430..698 178 24.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10481-PA 708 GJ10481-PA 4..702 2..699 2758 76 Plus
Dvir\GJ21796-PA 923 GJ21796-PA 49..769 19..644 623 29.4 Plus
Dvir\GJ17807-PA 996 GJ17807-PA 67..358 35..331 354 35.6 Plus
Dvir\GJ17807-PA 996 GJ17807-PA 556..991 343..692 345 26.8 Plus
Dvir\GJ17375-PA 865 GJ17375-PA 48..344 35..340 319 34.9 Plus
Dvir\GJ17375-PA 865 GJ17375-PA 424..857 343..692 287 26.8 Plus
Dvir\GJ20442-PA 1050 GJ20442-PA 156..436 423..704 259 29.4 Plus
Dvir\GJ21796-PA 923 GJ21796-PA 620..852 430..658 156 24 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11776-PA 702 GK11776-PA 7..699 10..702 2896 80.4 Plus
Dwil\GK20634-PA 935 GK20634-PA 47..776 19..679 560 28.6 Plus
Dwil\GK24446-PA 964 GK24446-PA 54..356 35..340 376 37.8 Plus
Dwil\GK24573-PA 833 GK24573-PA 16..313 28..332 373 34 Plus
Dwil\GK24446-PA 964 GK24446-PA 527..959 343..692 342 26.7 Plus
Dwil\GK24573-PA 833 GK24573-PA 389..825 340..692 322 25.1 Plus
Dwil\GK21381-PA 1059 GK21381-PA 170..442 431..704 271 29.9 Plus
Dwil\GK20634-PA 935 GK20634-PA 660..858 430..658 158 23.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24303-PA 705 GE24303-PA 1..705 1..705 3658 97.3 Plus
Dyak\GE18173-PA 861 GE18173-PA 46..853 28..692 605 27.4 Plus
Dyak\GE13742-PA 928 GE13742-PA 42..769 19..679 587 28.4 Plus
Dyak\GE17243-PA 947 GE17243-PA 32..350 23..340 407 37.2 Plus
Dyak\GE17243-PA 947 GE17243-PA 514..942 343..692 347 26.1 Plus
Dyak\GE13742-PA 928 GE13742-PA 619..890 430..698 175 23.7 Plus

RH18934.hyp Sequence

Translation from 125 to 2242

> RH18934.hyp
MLDLVHKATLHSMVCQAILVLICLLCYGCGGLSGAKFVFDDTVAIVKNRD
VNSLPTNWTAIFTHDFWGASLLSSDSHKSFRPLTTLMFHCEYALLGLSAA
HMKFLNLLLHCVNTLLMWRLIRSLYVPEVSTARWAILSAALFAAHPIHTE
AVSGVVGRAELMFGMIHLLCLLLTVANTGRLGPQTGGLIMLLTAVGMLFK
ESAVTIPMSCVLLDYFQNGYYHLRFKDQWSLLRTRISYLFYLLGTLGLLT
ARLWWQDFETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWL
CYDWALGCVKLVTNIWDLRLQGVIGFYSIVLVALMNFRRLPGMMLALGLM
IVPFLPASGIICVGFVIAERTLYVPSIGFCLLSIYGFLYWYDSSTENTHW
RTALRILLMLLFSVMMVRTRQRATDWLNEEQLFKSALQVCPDNAKVHYNI
ARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEY
IRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYY
NMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDAL
RISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLY
HTNLGVLYHRWDKTQEAIEAYRTAISISAARATTARENLSKLLKRLEREA
QVMQR*

RH18934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5038-PA 705 CG5038-PA 1..705 1..705 3713 100 Plus
CG4050-PB 926 CG4050-PB 40..785 19..698 673 28.9 Plus
CG4050-PA 926 CG4050-PA 40..785 19..698 673 28.9 Plus
CG4341-PC 908 CG4341-PC 21..313 34..331 407 37.4 Plus
CG4341-PA 938 CG4341-PA 51..343 34..331 407 37.4 Plus
CG4341-PC 908 CG4341-PC 475..903 343..692 341 25.9 Plus
CG4050-PB 926 CG4050-PB 617..888 430..698 209 24.1 Plus
CG4050-PA 926 CG4050-PA 617..888 430..698 209 24.1 Plus