Clone RH29536 Report

Search the DGRC for RH29536

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:295
Well:36
Vector:pFlc-1
Associated Gene/TranscriptCG6330-RB
Protein status:RH29536.pep: gold
Sequenced Size:2086

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6330-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH29536.complete Sequence

2086 bp assembled on 2009-09-22

GenBank Submission: BT099788.1

> RH29536.complete
GAGTTGGTTTCCAAACCTCGCGCAGCTCTGTTCGTCGCTCTTCTGTCCGT
TTTGCCATTGCGATTTAGTATCGGAAAAGAGAGTGTGTAGAAGAGGAAGA
AAGCGTTCCTGTTTGCTTCACGTGCCTACAGATAAACAAAGCAATTCAGC
AATCGAAATACCAACGAGAATATCGTGACAAGGCAACGCGATATAATAAT
AGTGCTGCGATTTTCTTTATTTGGTGCATATCAGGCAAATTACAGCCAAG
AGGCAACAACACAACACCTAGAACTCTTTACGCTCCCACCGCAAGATGTC
GCTGCTGCTCACCGGAAACAGTGCCTCCCTTTCCGAGGAGGAGCTCGACG
AGTACTCCGATGGAACCGTCAAATTGCGCAACTCGAACATTGAGCTCATG
GACCAGGATATCCTCTATCACCTGGCCTTGGGCAGCGAGAGCCACGACCT
GCAGGAGATGTTTGGCGACGTTAAGTTCGTTTGCATGGGCGGCACACCAA
AGCGCATGGAGAATTTTGCCCATTTCATAATGAACGAGATTGGCTACAAG
TTGCCAGCGGGCACCCAGCTGCAGGACATCAGCGCCTATTCGTATCGCTA
CTCCATGTACAAAGTGGGACCGGTGCTGTGCGTCAGCCATGGCATGGGTA
CGCCCTCGGTCAGCATCCTGATGCATGAGATGATCAAGCTGATGTACCAC
GCCAAGTGCAAGGATCCCGTCTTCATCAGGATAGGAACGTGCGGAGGAAT
TGGCGTCGACGGCGGCACCGTCATCATCACCGAAGATGCCCTCGATGGGC
AGCTGAGGAACTCCCATGAGTTTACCATTCTCGGCAAGACCATCCATCGT
CCTGCCAAGCTGGACAAAAAGCTGGCCCGTGAGCTAAAGTCCCTGGCCAG
TCCCGATGATCCGTACGATACCATTATTGGCAAGACGCTGTGCACCAACG
ATTTCTACGAGGGCCAGGGTCGTTTGGACGGCGCATTCTGTGATTTCAGC
GAGAACGAGAAGATGGCCTATCTGGAGAAGCTGCGCGAGAACGGCGTGGT
CAACATCGAGATGGAGAGCACCATCTTTGCGGCCCTGACCCACCATGCCG
GCATCAAGGCAGCGGTGGTGTGTGTCGCCCTGCTGAACCGCCTCAATGGG
GATCAGGTCAACGCGCCCAAGGAGGTCATGAACGAGTGGCAAGCGCGTCC
GCAGATCCTCGTGTCGCGCTATATTCGCAAGGTCCTTACGCACAATGGAC
AGCTGAAGGCGCTATTCGGACACCAGGGATCCATCAAGTCACCCCGGCGC
TTCAAGCTCGTCCAGCAGGAGTCTCAGGCCCACGAGTAAATGGGATCATG
TGACCAGTTCCATCTCATTTCACCTTCTTACATTATATGTGCGCATCTCT
CCAGTATACAATGATGTTTCAACATTCCCTAGTTTAGCTCTGATTAAGTT
CCTAGCTTTATTTCTGTGTATATCGCCCACAACCTCATCGGATAATTTAA
AACCGATCATATTGTACGTGCATATGTTCATATGTTACCACAATTTAATA
TATATATGTATATCAATAATATATAAAAATAGTATCACTGAGTGTGACGT
TCAAAGGTTATCAGAAATAAACGCTTTTGAGATCACAAAACAAATAACGA
ATAATATAGAAGAATTATGAAATTGTTAATTGTTATGTTGCATATTTTAA
ATGGGGCTAATCTATTAAGCAAAGATTCAACAATACCAAACAAAACTAAA
TGCTACATTTCCATTTTATAAATTATTATATTATAATGTATTGAAATTCC
TAAAGATTTGTTAAATGTACGTGTTGATTAGTGTTGCTACCGTACACTCG
ACTCTAAACCAAATCCAACAGCACTTAATCTTTCTCTGTCTAGTTATATC
CAAATTAAATGAAAACAATACGATGAAGAACAAAATGCTGAAAATAACAT
CAATACAATTACGGATAGCACACGATAAAACCAAATATACAAGTTATATT
GTAAAAAAACGAAATTTATGACAAATATTTCAACGGTATATTAAAAGAAA
TTGTAATTAAATTATACAAACCAAAAAAAAAAAAAA

RH29536.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330.b 2093 CG6330.b 13..2084 2..2073 10360 100 Plus
CG6330-RB 1930 CG6330-RB 13..1930 2..1919 9590 100 Plus
CG6330.a 2004 CG6330.a 274..1995 352..2073 8610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22772730..22773607 2072..1195 4360 99.8 Minus
chr3R 27901430 chr3R 22773676..22774047 1195..824 1815 99.2 Minus
chr3R 27901430 chr3R 22774110..22774466 823..467 1725 98.9 Minus
chr3R 27901430 chr3R 22781250..22781530 282..2 1360 98.9 Minus
chr3R 27901430 chr3R 22774813..22774936 475..352 620 100 Minus
chr3R 27901430 chr3R 22779554..22779626 354..282 365 100 Minus
chr2R 21145070 chr2R 18819267..18819443 777..601 360 80.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RB 1044 CG6330-PB 1..1044 296..1339 5220 100 Plus
CG6330-RA 1107 CG6330-PA 120..1107 352..1339 4940 100 Plus
CG3788-RB 1137 CG3788-PB 390..566 601..777 345 79.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:26:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RB 2075 CG6330-RB 5..2075 2..2072 10355 100 Plus
CG6330-RA 1541 CG6330-RA 252..1541 352..1641 6450 100 Plus
CG3788-RB 1758 CG3788-RB 928..1104 601..777 345 79.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PB 347 CG6330-PB 1..347 296..1336 1618 100 Plus
CG6330-PA 368 CG6330-PA 44..368 362..1336 1594 100 Plus
CG3788-PB 378 CG3788-PB 57..346 380..1246 847 59 Plus
CG3788-PA 378 CG3788-PA 57..346 380..1246 847 59 Plus
CG17224-PD 300 CG17224-PD 5..298 365..1237 605 44.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26949691..26950569 2073..1195 4395 100 Minus
3R 32079331 3R 26950638..26951009 1195..824 1860 100 Minus
3R 32079331 3R 26951072..26951428 823..467 1755 99.4 Minus
3R 32079331 3R 26958207..26958487 282..2 1405 100 Minus
3R 32079331 3R 26951775..26951898 475..352 620 100 Minus
3R 32079331 3R 26956517..26956589 354..282 365 100 Minus
2R 25286936 2R 22932746..22932922 777..601 345 79.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26690522..26691400 2073..1195 4395 100 Minus
3R 31820162 3R 26691469..26691840 1195..824 1860 100 Minus
3R 31820162 3R 26691903..26692259 823..467 1755 99.4 Minus
3R 31820162 3R 26699038..26699318 282..2 1405 100 Minus
3R 31820162 3R 26692606..26692729 475..352 620 100 Minus
3R 31820162 3R 26697348..26697420 354..282 365 100 Minus
2R 25260384 2R 22933945..22934121 777..601 345 79.6 Minus
Blast to na_te.dros performed on 2014-11-27 09:11:17 has no hits.

RH29536.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:39:14 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22781251..22781530 1..281 98   Minus
chr3R 22779557..22779626 282..351 100 <- Minus
chr3R 22774813..22774936 352..475 100 <- Minus
chr3R 22774110..22774457 476..823 99 <- Minus
chr3R 22773676..22774047 824..1195 99 <- Minus
chr3R 22772730..22773606 1196..2072 92 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:59 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1044 296..1339 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:10 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1044 296..1339 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:16:38 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1044 296..1339 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:14 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1044 296..1339 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 09:10:50 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1640 2..1641 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:09 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 1..1640 2..1641 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:16:38 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 4..2075 1..2072 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:14 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 4..2075 1..2072 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:39:14 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26958208..26958487 1..281 99   Minus
3R 26956520..26956589 282..351 100 <- Minus
3R 26951775..26951898 352..475 100 <- Minus
3R 26951072..26951419 476..823 100 <- Minus
3R 26950638..26951009 824..1195 100 <- Minus
3R 26949692..26950568 1196..2072 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:16:38 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22783930..22784209 1..281 99   Minus
arm_3R 22782242..22782311 282..351 100 <- Minus
arm_3R 22777497..22777620 352..475 100 <- Minus
arm_3R 22776794..22777141 476..823 100 <- Minus
arm_3R 22776360..22776731 824..1195 100 <- Minus
arm_3R 22775414..22776290 1196..2072 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:44 Download gff for RH29536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26699039..26699318 1..281 99   Minus
3R 26697351..26697420 282..351 100 <- Minus
3R 26692606..26692729 352..475 100 <- Minus
3R 26691903..26692250 476..823 100 <- Minus
3R 26691469..26691840 824..1195 100 <- Minus
3R 26690523..26691399 1196..2072 100 <- Minus

RH29536.pep Sequence

Translation from 295 to 1338

> RH29536.pep
MSLLLTGNSASLSEEELDEYSDGTVKLRNSNIELMDQDILYHLALGSESH
DLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSY
RYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCG
GIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKSL
ASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENG
VVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQA
RPQILVSRYIRKVLTHNGQLKALFGHQGSIKSPRRFKLVQQESQAHE*

RH29536.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18559-PA 368 GF18559-PA 37..368 16..347 1628 94 Plus
Dana\GF11317-PA 383 GF11317-PA 48..346 18..314 941 56.9 Plus
Dana\GF18560-PA 300 GF18560-PA 3..297 23..314 659 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12162-PA 368 GG12162-PA 20..368 7..347 1668 93.1 Plus
Dere\GG20084-PA 378 GG20084-PA 46..346 18..317 953 56.5 Plus
Dere\GG24468-PA 308 GG24468-PA 1..306 12..314 710 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19373-PA 346 GH19373-PA 3..346 4..347 1753 93.3 Plus
Dgri\GH19384-PA 350 GH19384-PA 51..337 29..314 916 56.8 Plus
Dgri\GH19395-PA 301 GH19395-PA 7..301 25..316 733 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PB 347 CG6330-PB 1..347 1..347 1806 100 Plus
CG6330-PA 368 CG6330-PA 23..368 10..347 1724 96 Plus
CG3788-PB 378 CG3788-PB 46..346 18..317 932 57.5 Plus
CG3788-PA 378 CG3788-PA 46..346 18..317 932 57.5 Plus
CG17224-PD 300 CG17224-PD 2..298 21..314 693 45.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22212-PA 363 GI22212-PA 33..363 17..347 1676 93.1 Plus
Dmoj\GI22215-PA 360 GI22215-PA 54..340 29..314 933 57.1 Plus
Dmoj\GI22213-PA 297 GI22213-PA 5..296 26..314 706 45.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27259-PA 365 GL27259-PA 33..365 15..347 1675 91.9 Plus
Dper\GL23743-PA 373 GL23743-PA 53..344 22..312 916 55.1 Plus
Dper\GL25985-PA 256 GL25985-PA 1..243 79..321 739 54.5 Plus
Dper\GL27260-PA 297 GL27260-PA 5..295 25..314 715 44.7 Plus
Dper\GL25965-PA 223 GL25965-PA 73..218 24..170 454 55.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19516-PB 347 GA19516-PB 1..347 1..347 1746 92.8 Plus
Dpse\GA19516-PA 365 GA19516-PA 33..365 15..347 1675 91.9 Plus
Dpse\GA26722-PA 373 GA26722-PA 53..344 22..312 915 55.1 Plus
Dpse\GA23650-PA 377 GA23650-PA 63..353 24..314 887 54.8 Plus
Dpse\GA27021-PA 297 GA27021-PA 5..295 25..314 720 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10155-PA 347 GM10155-PA 1..347 1..347 1861 99.4 Plus
Dsec\GM15599-PA 378 GM15599-PA 46..346 18..317 969 57.5 Plus
Dsec\GM18176-PA 300 GM18176-PA 2..298 21..314 719 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18110-PA 347 GD18110-PA 1..347 1..347 1861 99.4 Plus
Dsim\GD25095-PA 378 GD25095-PA 46..346 18..317 971 57.8 Plus
Dsim\GD12000-PA 279 GD12000-PA 2..279 21..295 675 46.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24332-PA 346 GJ24332-PA 3..346 4..347 1711 90.7 Plus
Dvir\GJ24333-PA 343 GJ24333-PA 37..323 29..314 969 59.9 Plus
Dvir\GJ24335-PA 303 GJ24335-PA 1..283 35..314 784 50.5 Plus
Dvir\GJ24336-PA 299 GJ24336-PA 5..297 25..314 755 48.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11445-PA 368 GK11445-PA 20..368 7..347 1695 90.3 Plus
Dwil\GK15591-PA 371 GK15591-PA 49..345 19..314 913 54.9 Plus
Dwil\GK11446-PA 299 GK11446-PA 4..298 24..314 756 45.9 Plus
Dwil\GK11364-PA 363 GK11364-PA 30..344 2..314 732 45.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10606-PA 347 GE10606-PA 1..347 1..347 1859 99.1 Plus
Dyak\GE11621-PA 382 GE11621-PA 46..346 18..317 960 57.1 Plus
Dyak\GE14961-PA 300 GE14961-PA 2..298 21..314 714 44.8 Plus

RH29536.hyp Sequence

Translation from 295 to 1338

> RH29536.hyp
MSLLLTGNSASLSEEELDEYSDGTVKLRNSNIELMDQDILYHLALGSESH
DLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSY
RYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCG
GIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKSL
ASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENG
VVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQA
RPQILVSRYIRKVLTHNGQLKALFGHQGSIKSPRRFKLVQQESQAHE*

RH29536.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PB 347 CG6330-PB 1..347 1..347 1806 100 Plus
CG6330-PA 368 CG6330-PA 23..368 10..347 1724 96 Plus
CG3788-PB 378 CG3788-PB 46..346 18..317 932 57.5 Plus
CG3788-PA 378 CG3788-PA 46..346 18..317 932 57.5 Plus
CG17224-PD 300 CG17224-PD 2..298 21..314 693 45.2 Plus