Clone RH36157 Report

Search the DGRC for RH36157

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:361
Well:57
Vector:pFlc-1
Associated Gene/TranscriptUsf-RA
Protein status:RH36157.pep: validated full length
Preliminary Size:1655
Sequenced Size:2753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17592 2002-01-01 Sim4 clustering to Release 2
CG17592 2003-07-26 Blastp of sequenced clone
Usf 2008-04-29 Release 5.5 accounting
Usf 2008-08-15 Release 5.9 accounting
Usf 2008-12-18 5.12 accounting

Clone Sequence Records

RH36157.complete Sequence

2753 bp (2753 high quality bases) assembled on 2003-07-26

GenBank Submission: BT009958

> RH36157.complete
GCCTTGAATTGCTGGCGAAGCATTGTTCCAATCGGCGGCGATCCACTCCG
GTGACCCCGAACTCCTCTGCCGTCTGATGGTACTGGCGAAGGGGATCCTC
CAGGCGAAGCAGCGTGTCCGTTACATCGAAGGTCACCAGGCGAAAGCGTT
TCAAATTCGCAACAAATTGCGAAGTCAACGACATTTTGGCCAACAGTGTG
GTATTGTTTGTCCACTAGATATTACGTATATGCATTTGGTATATTTTAAT
TTTCGAAAAACCTCCAAAAACACATTTGCTTAGTTGAGAATCGTTTGTTG
AATTAAATGAAGATGCTTTTCTTCATTTTAAAGTTACAGATTTTCTACTT
GTATGAAGAGTTTATTTTTTTTTTTGAATACAAACAATTATTTGGAAATG
CCGCAAAAATACATTGCCTAAATTCTGGTATTTTTCGCAACAACTGTACT
GTGTGTATTCGTCGGCATATATTTGCTGCCCGCCGGCGGGCACACTAAGC
CAAACGAAAATAATTTTGTTACAAAAAAAATCAACAAATCGTATTGTTAA
ATGGCCGTGCGAACACGAACGACCATAAATCCGCCGCAGCGCTCGATTTC
AAATCAAATCCTCGAGGCAGTCGGTAGTTAATAATACCGCAGAGCGGCCA
GATCGGGGGATATCTACCATCCATATCCGTGTATCCTCCAACTAGAGATC
GGAGCAAATAGTGGAGGAGATCCCGAATAGATCCGGAGTTACGTGATTCC
CGGCGACACGGATACGATTCTGGCTGGGATTGGGCTATTGGAATTGGTGT
ACTGCTAACGGCGGATCATCGATGCAACAATGAATGTTCACAAGCGGCCA
CGTCTGAATATGGAATTCGGCTCCTCCACCAGCAATACCAACACTTCCAC
ATCCCCGTCCTCCGTAAATATCAGCAATGCGAATCCAACAGCTGGACCTG
GCCTCATGACCATTACCAATCACCACACCGCTGATTTGTCAGAGGCCCTG
GTCCACAGTTCCTTTGCCAATGGTCAGCAAAGTCTGATTCTCACCAGCGA
CACGGGAAATCCGCTGATGAATAGCCAAGGTGCTCAGATATTTCTCACCA
TTTGCGGAGACGAGAACTCGGACGATTCGCAGGAGTACTATACGATTAAA
CAGGAACCGGGATGTGATCTAGATATCCATTCGCTGCTGCCTAGCAATTT
GCAGCTGCCCAACAATCTGCAGCTGCCCACTGGCTGTGAGATATATTTGG
TCAAGGAAACCGGCAGCTTAATGGGTGAGCCGCCGACGAAGGCGGCCATC
AAGCTGGAACTAGATACGCTAAGCGAAAAGCCGCTCCTTCCATCTGTTAC
AACTTCCTCCAGCACACAGTCCGCGGTAATAACCGCCCAGACCGTGAATC
CTCCCATTCCAGGTAACATCAACACCACCACCAGCACCACTAGCACCACC
ACCACCACCAGTGTCCTGTATGGCTCCCATGGCAATGGTCATGGCCATGG
CCATGCTCACGCCCAAGCCCGATCCCAGCCAGAATCAGCTGGCCAAACAC
CATCCAGCAAACTGGAGGCGTACAAGAAACGCGATGATAAACGTCGTGCC
ACGCACAACGAGGTCGAACGCCGGCGCCGCGACAAGATCAACAGCTGGAT
CTTCAAGCTCAAGGAGATGCTGCCCAGTCTGAGCTCCAGCTCCAGTTTCA
GCGAGGCCAGCACGAGTCCCAGCACCAGCGGAAGTACGAGTACCAACGGA
AGTAGCCATTCCAAAGGCAATGCCAGCAGTTCCAGCGGACGAGCGCCGCC
CAATGACTCCAAATCGCAGATCCTGATCAAGGCATGCGAGTACATCAAGA
GCATGCAGGGCGAGATTGACACGTGAGTGGAGACGGGTTTGTAGGGGGGA
AACCACTGAATCAGAAATCCACAAATATTGTCCGCTATAAGTTGCTGTAC
TACAGTTATATATACAGCTATATAACTTTTTTGACTTGTTAATGGTCTTA
AAAAATGAGTTTGCTTATAGATCTTAATCAACTCCATTCGCTCAATTGAG
CTTACATCATGTATCGATCGCATACGGTTAGGAATAAAGTTACCCAAAGG
GCGGACACTTGATCTTTCCCACTTTTTCCGTAGAAATGCGTACTTAAAGT
GCTGATATAGGGCTGGTGTTATCTTTTTGCAAAACAAAATCCCCATTTTG
GAGCGGTTCTTTTTCGCCACTATCTCGTGCAATATGAGCTGGACTCTCGA
ATGTCCCTGTGTCACTCAAGTCTTGAACACAACACTCTCTCACACTGATC
GAATGCGGTTTCCACCCAAACAAAACCCAACAAAATCATACAAAGCCAAT
CAAACACCTGATCCACCGATTCACCGATCACCAAACATAAACAAACCAAT
TACTCAACTTTGTCTATCCCCACCAATAAACAGGCTGCGCGACTGTCTAA
GGGAGACGGATAGCCTAAGGGCCAGCAACCAGGCGCTGCGCGAGGAACTT
GATCGCCTGAAGCGTCAGCAGCAGCTCCAGGAACGCTTCCACACGGCCGG
CGGAAGATCGACGTTTAATGTTACCCTAAATTCGCTGAACAGTTCCGCGA
CCAGTGATCTATTCGAGGGAATCGATACGACACCCAATCTGGCCGCCGTC
TCGTCGCTGGGATTCGGCAAGCGTGGCCTGCTGATCAGCGATTTTGATGA
GTAAACAAAATCTGCCTGCGAAATAGGAGTGGATAGACAAAAAAAAAAAA
AAA

RH36157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-RB 3074 Usf-RB 1..1481 393..1873 7390 99.9 Plus
Usf-RB 3074 Usf-RB 1477..1800 2430..2753 1605 99.6 Plus
CG15912-RA 888 CG15912-RA 1..189 188..1 905 99.4 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4439407..4442154 2738..1 13190 98.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-RC 1314 CG17592-PC 1..1044 830..1873 5220 100 Plus
Usf-RB 1314 CG17592-PB 1..1044 830..1873 5220 100 Plus
Usf-RC 1314 CG17592-PC 1040..1314 2430..2704 1360 99.6 Plus
Usf-RB 1314 CG17592-PB 1040..1314 2430..2704 1360 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:27:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-RC 3617 CG17592-RC 1..1410 464..1873 7050 100 Plus
Usf-RB 2954 CG17592-RB 1..1410 464..1873 7050 100 Plus
Usf-RC 3617 CG17592-RC 1406..1714 2430..2738 1530 99.7 Plus
Usf-RB 2954 CG17592-RB 1406..1714 2430..2738 1530 99.7 Plus
CG15912-RA 888 CG15912-RA 1..189 188..1 895 99.5 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-PC 437 CG17592-PC 1..348 830..1873 1099 100 Plus
Usf-PB 437 CG17592-PB 1..348 830..1873 1099 100 Plus
Usf-PC 437 CG17592-PC 346..437 2426..2701 447 97.8 Plus
Usf-PB 437 CG17592-PB 346..437 2426..2701 447 97.8 Plus
CG15912-PA 246 CG15912-PA 1..56 17..184 286 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4546505..4549258 2753..1 13690 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4554603..4557356 2753..1 13700 99.8 Minus
Blast to na_te.dros performed on 2014-11-26 20:52:38 has no hits.

RH36157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:47:29 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4439407..4442154 1..2738 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:45:32 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RA 1..1047 830..1876 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:30:42 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1044 830..1873 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:08:43 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1044 830..1873 100 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:04:15 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RA 1..1047 830..1876 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:29 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1044 830..1873 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:31:37 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RA 1..2739 1..2738 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:30:42 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1385 489..1873 100 == Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:43 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1385 489..1873 100 == Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:04:15 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RA 1..2739 1..2738 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:29 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
Usf-RB 1..1410 464..1873 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:47:29 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
X 4546520..4549258 1..2738 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:43 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4440553..4443291 1..2738 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:42:21 Download gff for RH36157.complete
Subject Subject Range Query Range Percent Splice Strand
X 4554618..4557356 1..2738 99   Minus

RH36157.hyp Sequence

Translation from 829 to 1875

> RH36157.hyp
MNVHKRPRLNMEFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHT
ADLSEALVHSSFANGQQSLILTSDTGNPLMNSQGAQIFLTICGDENSDDS
QEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGE
PPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTT
TSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKK
RDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTS
GSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDT*

RH36157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-PC 437 CG17592-PC 1..348 1..348 1787 100 Plus
Usf-PB 437 CG17592-PB 1..348 1..348 1787 100 Plus

RH36157.pep Sequence

Translation from 829 to 1875

> RH36157.pep
MNVHKRPRLNMEFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHT
ADLSEALVHSSFANGQQSLILTSDTGNPLMNSQGAQIFLTICGDENSDDS
QEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGE
PPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTT
TSTTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKK
RDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTS
GSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDT*

RH36157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19532-PA 392 GF19532-PA 1..302 1..348 683 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18536-PA 419 GG18536-PA 1..330 1..348 1184 75.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24300-PA 429 GH24300-PA 1..340 1..347 494 39 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Usf-PC 437 CG17592-PC 1..348 1..348 1787 100 Plus
Usf-PB 437 CG17592-PB 1..348 1..348 1787 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11046-PA 407 GI11046-PA 224..320 244..348 331 59 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19758-PA 493 GL19758-PA 288..397 244..347 332 64.9 Plus
Dper\GL19758-PA 493 GL19758-PA 40..196 52..225 291 43.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14568-PA 492 GA14568-PA 287..396 244..347 333 64.9 Plus
Dpse\GA14568-PA 492 GA14568-PA 40..196 52..225 290 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12686-PA 423 GM12686-PA 1..334 1..348 1363 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16293-PA 598 GD16293-PA 1..342 1..348 1401 92 Plus
Dsim\GD16293-PA 598 GD16293-PA 342..509 178..348 515 89 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17043-PA 421 GJ17043-PA 49..333 56..347 484 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15417-PA 766 GK15417-PA 573..668 247..347 323 64.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16852-PA 422 GE16852-PA 1..333 1..348 1255 76.7 Plus