Clone RH44336 Report

Search the DGRC for RH44336

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:443
Well:36
Vector:pFlc-1
Associated Gene/TranscriptAdf1-RC
Protein status:RH44336.pep: gold
Sequenced Size:1692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Adf1-RC 2008-10-21 Manual selection by Sue Celniker

Clone Sequence Records

RH44336.complete Sequence

1692 bp assembled on 2009-07-27

GenBank Submission: BT088961.1

> RH44336.complete
GAATTGGCAGAGACGCGACTGAGCTGGGACGTACCGTTACCGTTGGCAGA
GACGCGACTGAGAAATAAAATTAAAACGTCGACGTTCCTTCCTCGTAGAA
GAAACCAATCAAAATAAAAACAAACAGAGCGTGCGTTCGCGCCAAATACT
TAACAACAATTAGCAAACGTAAGAAGCAAATGCATACCCTCACGGCGGCC
ATTGAGATGGACAAGCTGGATGCCAATCTTGAGCAGCAGTTTGATCTCAA
TCTCATCGAGGCTGTCAAGCTGAACCCAGTGATATACGACAGGTCGCACT
ACAATTACAAGCACTTTGTGCGCAAGGCCCAGACCTGGAAACAAATCGCC
GAAACGCTCGGTGTGCCTGAACAAAAATGTACGAAGCGCTGGAAGAGTCT
GCGCGACAAGTTCGCCCGCGAGATGAAACTATGTCAGGAATCGCGCTGGC
GTTACTTCAAGCAGATGCAATTCCTGGTTGACTCCATCCGCCAGTATCGA
GAGTCGCTGCTCGGCAAGTGCGCCAATGGGAGTCAAAGCGCCAACCAGGT
GGCCGATCCGTCGCAGCAGCAGCAGGCGCAGCAACAGACCGTCGTGGATA
TATTTGCACAGCCCTTCAACGGCAGCGCCACAACCTCGGCCCAGGCACTG
ACCCATCCGCATGAAATTACTGTCACCAGCGATGCACAGCTGGCCACTGC
CGTGGGCAAGGACCAAAAGCCATACTTCTACGAGCCGCCGCTCAAGCGAG
AGCGCAGTGAGGAGGAGCACAGCGACAACATGCTCAACACCATCAAGATT
TTCCAAAACAACGTCTCGCAGGCGGTCAGCGCCGAGGACCAGTCGTTCGG
CATGGTAGTCACGGACATGCTCAACACGCTGGGCGTGCGACAAAAGGCAG
AGGCGAAGGTGCACATCATCAAGTATCTGACGGACATGCAGCTTCTGGCA
CAGCACAACAAGTACTAACTGTCGGGCGGCTGTCATCGGCAGCTGCTGCA
GCTGCTCCAACTGGAGAGCGTTCTGCCCTGAGATCAAACGAGAACAGACC
CACGGCTACCCACATCCACATCTACACGGGTTTGGGGGTCCTGTGCGGTC
ATTTTCTACAGTTCATAGGTCTTAAAGTCAAACTACAGAATAACATTAGA
CGTAACATCCCACAGCGTAAACCATAACGCGTAATGATACTTCCCCACGC
CCATGTAGACAAACATATATATTTATATGCTTAGTTGACCCCATGATCGG
TGATTTAATTCGCGCCCAGTTCTCAGCTCTGTACAAAAAATGCGATTGAA
AATAGCGATTCTAGAATTATGAGTAGCTTGTTAAAAGACCGTGGAAACAC
TTTATATGCAGCGTATTGTAAATTTTGACTACGATTTAGTTGTAATTTGC
CATCGGGTCTTAGCTCTAAAACTAAGTATACACGTAAAAGTTATTTTAAT
TTTATAAGTTCTGTTGTAATATGCCGAAAACGCTTGAAAGACACTTTGAA
ATGCTTAATTAAGTGTGACAAAGGGAAACATAAAACACCTTTTTCATAGT
GATCGCATATTACACACTTTACATGGATACGAGTAAAATCGAAATAGTTG
CCGGCAACGCCAGTTGCTAAACATTTTTAATGATTAATTGTGCAATTATT
TGGTATTAAATGAAACATTTGAAAGCAAAAAAAAAAAAAAAA

RH44336.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RC 1841 Adf1-RC 60..1733 2..1675 8370 100 Plus
Adf1-RB 1961 Adf1-RB 359..1853 181..1675 7475 100 Plus
Adf1-RA 1829 Adf1-RA 227..1721 181..1675 7475 100 Plus
Adf1-RB 1961 Adf1-RB 60..238 2..180 895 100 Plus
Adf1-RA 1829 Adf1-RA 60..226 2..168 835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2554264..2555276 663..1675 5065 100 Plus
chr2R 21145070 chr2R 2553911..2554205 369..663 1475 100 Plus
chr2R 21145070 chr2R 2549762..2549950 181..369 945 100 Plus
chr2R 21145070 chr2R 2549463..2549641 2..180 895 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 825 CG15845-PE 1..825 207..1031 4125 100 Plus
Adf1-RC 789 CG15845-PC 1..789 180..968 3945 100 Plus
Adf1-RB 762 CG15845-PB 1..762 207..968 3810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RC 1675 CG15845-RC 1..1674 2..1675 8370 100 Plus
Adf1-RE 1668 CG15845-RE 6..1667 2..1675 8155 99.3 Plus
Adf1-RA 1668 CG15845-RA 6..1667 2..1675 8155 99.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PE 274 CG15845-PE 1..274 207..1028 1318 99.6 Plus
Adf1-PC 262 CG15845-PC 1..262 180..965 1308 100 Plus
Adf1-PB 253 CG15845-PB 1..253 207..965 1264 100 Plus
Adf1-PA 253 CG15845-PA 1..253 207..965 1264 100 Plus
CG10949-PB 459 CG10949-PB 129..221 204..476 171 41.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6668084 663..1675 5065 100 Plus
2R 25286936 2R 6666719..6667013 369..663 1475 100 Plus
2R 25286936 2R 6662569..6662757 181..369 945 100 Plus
2R 25286936 2R 6662270..6662448 2..180 895 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6668271..6669283 663..1675 5065 100 Plus
2R 25260384 2R 6667918..6668212 369..663 1475 100 Plus
2R 25260384 2R 6663768..6663956 181..369 945 100 Plus
2R 25260384 2R 6663469..6663647 2..180 895 100 Plus
Blast to na_te.dros performed 2014-11-26 19:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 6929..6987 70..128 115 66.1 Plus

RH44336.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:39 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2554265..2555276 664..1676 99   Plus
chr2R 2553912..2554205 370..663 100 -> Plus
chr2R 2549762..2549950 181..369 100 -> Plus
chr2R 2549462..2549641 1..180 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:55 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 1..789 180..968 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:26 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 1..789 180..968 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:27:31 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RE 1..825 207..1031 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:39 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RE 1..825 207..1031 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 17:54:00 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 2..1675 2..1676 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:26 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 2..1675 2..1676 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:27:31 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 1..1674 2..1676 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:39 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 1..1674 2..1676 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:39 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6668084 664..1676 99   Plus
2R 6666720..6667013 370..663 100 -> Plus
2R 6662569..6662757 181..369 100 -> Plus
2R 6662269..6662448 1..180 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:27:31 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2555589 664..1676 99   Plus
arm_2R 2554225..2554518 370..663 100 -> Plus
arm_2R 2550074..2550262 181..369 100 -> Plus
arm_2R 2549774..2549953 1..180 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:08 Download gff for RH44336.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668272..6669283 664..1676 99   Plus
2R 6667919..6668212 370..663 100 -> Plus
2R 6663768..6663956 181..369 100 -> Plus
2R 6663468..6663647 1..180 99 -> Plus

RH44336.pep Sequence

Translation from 179 to 967

> RH44336.pep
MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKA
QTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLV
DSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSA
TTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDN
MLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYL
TDMQLLAQHNKY*

RH44336.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11060-PA 535 GF11060-PA 274..535 1..262 1420 98.5 Plus
Dana\GF15373-PA 460 GF15373-PA 141..255 25..130 182 35.6 Plus
Dana\GF10717-PA 679 GF10717-PA 302..398 16..105 154 33 Plus
Dana\GF15373-PA 460 GF15373-PA 3..102 22..112 149 34 Plus
Dana\GF17699-PA 337 GF17699-PA 28..121 20..107 146 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23211-PA 253 GG23211-PA 1..253 10..262 1367 99.6 Plus
Dere\GG21572-PA 459 GG21572-PA 141..391 25..245 179 25.6 Plus
Dere\GG13380-PA 678 GG13380-PA 39..139 22..117 154 33.3 Plus
Dere\GG21572-PA 459 GG21572-PA 3..102 22..112 152 35 Plus
Dere\GG13380-PA 678 GG13380-PA 306..402 16..105 150 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21743-PA 253 GH21743-PA 1..253 10..262 1297 96.8 Plus
Dgri\GH14617-PA 770 GH14617-PA 402..498 16..105 167 35.1 Plus
Dgri\GH11654-PA 502 GH11654-PA 142..236 25..116 164 40.8 Plus
Dgri\GH11654-PA 502 GH11654-PA 3..88 22..101 151 36 Plus
Dgri\GH20726-PA 334 GH20726-PA 12..95 22..99 151 32.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PC 262 CG15845-PC 1..262 1..262 1355 100 Plus
Adf1-PB 253 CG15845-PB 1..253 10..262 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 10..262 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 10..262 1311 100 Plus
CG10949-PB 459 CG10949-PB 129..391 9..245 173 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19291-PA 253 GI19291-PA 1..253 10..262 1301 97.2 Plus
Dmoj\GI17956-PA 461 GI17956-PA 142..253 25..137 172 37.8 Plus
Dmoj\GI13504-PA 728 GI13504-PA 349..454 16..116 165 34.3 Plus
Dmoj\GI20810-PA 335 GI20810-PA 12..95 22..99 149 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11108-PA 250 GL11108-PA 1..250 10..262 1249 93.7 Plus
Dper\GL26413-PA 448 GL26413-PA 140..254 25..130 156 33 Plus
Dper\GL20873-PA 737 GL20873-PA 306..402 16..105 151 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13983-PA 250 GA13983-PA 1..250 10..262 1249 93.7 Plus
Dpse\GA10661-PA 448 GA10661-PA 140..254 25..130 156 33 Plus
Dpse\GA21303-PA 697 GA21303-PA 320..416 16..105 151 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20885-PA 253 GM20885-PA 1..253 10..262 1367 99.6 Plus
Dsec\GM23328-PA 459 GM23328-PA 141..391 25..245 186 26.8 Plus
Dsec\GM16842-PA 683 GM16842-PA 35..135 22..117 153 32.4 Plus
Dsec\GM10256-PA 336 GM10256-PA 28..121 20..107 152 36.2 Plus
Dsec\GM16842-PA 683 GM16842-PA 302..398 16..105 151 32 Plus
Dsec\GM23328-PA 459 GM23328-PA 3..102 22..112 150 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10415-PA 253 GD10415-PA 1..253 10..262 1367 99.6 Plus
Dsim\GD21703-PA 459 GD21703-PA 141..391 25..245 182 26.8 Plus
Dsim\GD21228-PA 336 GD21228-PA 28..121 20..107 152 36.2 Plus
Dsim\GD12257-PA 682 GD12257-PA 35..135 22..117 152 32.4 Plus
Dsim\GD12257-PA 682 GD12257-PA 302..398 16..105 151 32 Plus
Dsim\GD21703-PA 459 GD21703-PA 3..102 22..112 150 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22167-PA 253 GJ22167-PA 1..253 10..262 1351 98 Plus
Dvir\GJ11865-PA 706 GJ11865-PA 338..443 16..116 165 34.3 Plus
Dvir\GJ20543-PA 330 GJ20543-PA 12..95 22..99 152 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23084-PA 253 GK23084-PA 1..253 10..262 1250 96.9 Plus
Dwil\GK18122-PA 430 GK18122-PA 149..229 25..99 165 43.2 Plus
Dwil\GK25760-PA 693 GK25760-PA 305..403 16..105 150 32.3 Plus
Dwil\GK18122-PA 430 GK18122-PA 3..88 22..101 147 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19065-PA 253 GE19065-PA 1..253 10..262 1367 99.6 Plus
Dyak\GE12593-PA 459 GE12593-PA 141..321 25..187 179 30.2 Plus
Dyak\GE22473-PA 679 GE22473-PA 311..407 16..105 151 32 Plus
Dyak\GE22475-PA 745 GE22475-PA 378..474 16..105 148 32 Plus

RH44336.hyp Sequence

Translation from 179 to 967

> RH44336.hyp
MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKA
QTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLV
DSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSA
TTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDN
MLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYL
TDMQLLAQHNKY*

RH44336.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PC 262 CG15845-PC 1..262 1..262 1355 100 Plus
Adf1-PB 253 CG15845-PB 1..253 10..262 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 10..262 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 10..262 1311 100 Plus
CG10949-PB 459 CG10949-PB 129..391 9..245 173 25.7 Plus