Clone RH44958 Report

Search the DGRC for RH44958

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:449
Well:58
Vector:pFlc-1
Associated Gene/TranscriptCG32643-RA
Protein status:RH44958.pep: gold
Sequenced Size:3660

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32643-RA 2009-01-21 est gleaning

Clone Sequence Records

RH44958.complete Sequence

3660 bp assembled on 2009-07-15

GenBank Submission: BT088926.1

> RH44958.complete
GCTCTAGTGCTTCCAAATTACTTCCAAAAATCATGTCCAGCCAGCAAAAA
CCCATCAATGTTTACGTGCCGCCGATCAGCAGTTTTCCCGAAGCCAGTTT
CCTGGGTGGCTATGGACTGCAGGATCGCATTGAGGTGCCCAAGAGCGCGG
AAGTCCTTGAGGATGTCATCGATGAGCGGGACGCGCACTTCCTCTACGTA
GTCGATAGCCAGGGACGCCTGTTGGAGCACATACGTTACTACGGGGACGA
TTACCGGATGGCTTTGCGTGAGGCCTTCACCACGAAAGTCCTTGACCAAC
AGAATACTGGCGCAGATCTCCCATTGAATCGGGAATAGCGAAGGAACGAG
GAACCATGCCAGTGTACACAACAAATGAATTAACTGTTTCAATTAGAGCA
CTTCATTGCTCGATGGCCGGAAAATCAAGTACAAATTCGCTATAATTCCC
GCCTCGTTGGTTACATGCGAATTTAGGAAATATAGACAAATTGAATTCAA
CAAATTAAGTTCATGGTCAATTTTTAACTTTGTGAAATCCATAAGTTTAG
AAATCTTTTTTTTTTTTATAACTTTATCGAATAGGCTGTTTTTAAGTCGA
CTATCTGGGATGATTGCAACTTTTGGAATTTTTGCAAAAGTAATTTTTTT
TTCCCTTTTGGGATCCAGCGAGCTATTTGTTATGTACCGCATTTCGAAGC
GTACATATTTGCACAACAGATGAGCCACTTCAGCGAATTTTCCCCCCTTT
CTGGCTCTCAGGAATGGTAGATAAAAATATTTGTATTTACTTTCTGGTCA
CAATTTGTGAAAAACGAATTCTTTATTATTTTTTTCGGTTGTAAAAATGA
AATGTGGAAAACGAATTACACTTGCATCGGCATGTGTTGGGCATGCAGAT
GGGATCCGTATCGCTGTTTGCATCTCCATCTGCATCTACACCTGAAAATG
AATCCGTATCTGCAGGTATTTGCGTGAGTTACTTCGTTGCATAATGTGGT
TTTTATGGCCGCTGAATTTAATATGTTACGTATTCACACTAGAAATATGT
AAAGTCCTGTGTAAACAACTGAATAAATTACATATTTTGCAAGGAGTCGA
TATCTGCAAATCATCAGTAATCAAATTATAGATTTAATAACTACGTACTC
ACAGTTGAGACGCACATTCGAACAGTTTACTGAAAATGTATGGTTCGTAA
ACCATTTACTGACCATAGAACTAATGAAAGAGGGATGTTCAACAATAATT
ACCCTGGTGAAAATATAGAAAATAATTACAAAATATTTACCAGCAGTTGA
AATCGTGTGGATCTGTTAGTGCCGTTTTAAGTGCCCTGTAAATTCGGATA
ATTGAGCTTGCATAAAAATTGCGTATTCGCCCCGTTGCCCCTGCCTCAGT
GCAATTTATATGTTTCTGCATTGCTACCCGATCTACCGTTTTAGGACCTG
AATGGATGGGTATTATGTTAAATTTTATTGGCGTTCTCGCTATGGCAACT
GGTCAAAAGGACAGGATATCTGGATAACTGGACTGGAATGCCGTCGCCTG
CACCGCACTTATAGCCTTGAGAATTGTTAAAAAAGAAAAGAATTTAGCTC
CATTGCCATGGAAGCCAATTTGTCCATACGTAAACACCTGAGCCCCCATA
GAGCTAACTCAGCTGAATACCATTTAGCTCCCTAATTGGATAGGTTACAT
ATCATTTTGGGCGTGTGTGTATCAGGGTAGATTACCATGTTGTCTCGTTT
TGACTGAGTGCCCAAAAACTAAAAGGTGAATGCAAAATCTCATGTTGATT
GAGTCCTTTTGGTTGAGGACTTCATTACCACGAACCACATTCTGATATAC
AAAATTCCAAAGAAACTTTACAAAGACTGTGCCTGGCCTACTAATGATTC
GCAAAAGGCTTACAAATTTGAAAAGATTTATGCAAAATAAATAACTTAAG
TCGAGAGTTAAGAAACTTAAAAATTGAAGTCCTACAGGCATGGAATTAAA
TTCCAAATTGACTATCGTTGAAGCCAACAGTATTGACTATTTTTATAGCC
TATCTTATAGTTTATCAACTATTAACGGAATATAGAACAAATATTATAAA
GTCAAGCATGCTTTGAAATAAATCCATTTCAATTTACTTATTACCAACTA
AATAATACTTACTTCATATGTCGATGAACATTTTTTTGATTGATAATCGG
TTTTAATGTAAATACTTATAAATATGAATCAGTTTAAAAATAAATGTGTT
CTGAACTTTTGTTTGCTTAAGAATACCTTTAAAAGCTGCTTAATTGCGAA
GATTGGTGATTTTGGTAATGGAAAAATTTTAAAGATTTTTATGGAAGTTT
TCAATGAATCGTGCATTTGTTTTGTTAGCCTAAAAGGGCCGTTCTTTGAA
GAATCGTTTTCCCCAAAAGACTGGATTCGCCGATTCTCAACTTTTCCCCT
TCAAAAAACTGAAAGCCAAAAAATCAAAAAAACAACCACTGAAAGTGCTG
AATCGGTTGAACCAATCCTAGTGATTCCGAGGATTCTCCGCCAGATTTTA
GACGCCTTCGCGTCTGGGGCATGCGCTGAATGTGCACCGGGTGCGAGCGA
GATGGCAACCGGGTGCGAGCGGGACGGGGCGAGGCCGACAAGCGGAGTAA
TCGGTGTCCTTGGCTGGGGCACAAGACTCAAGGCTAACCTGTTGACAAAG
TGCATATTGCGCATACGCCCCATACGGCGCACAAGTCCAACAGGTAAGCC
GCTGGCGTAGGCGTTGCACATCCATCCACACAGTCGCCAAAAAAAGCCCA
CCCACCCACCGAAATCCGCCCACCGAAATCCTCCCACTGAACCACGCGCA
ACCTTGCCGTTGGCACTCGGACCTACCAAGGCTAACAAGGCGCCAATAGC
ATTGATCTGCGTAAATCAAGTTACCAGAATTACAGCCAGCCGCCTTCGCA
CTGGATACAATTGCATTGCCTCATTCAGCAACTGCACACAATGGTCATTA
CCATTATTGCAGGAAACAGCCTTCACTTATGCTATAGTCTTTGATTATTC
AATGTTAAAATCATTTTGTAATTTTGTAGCTTTAAGTGAACAATAAACTT
AAAACACACAATATTCTCTGAACTTGATTTATATAATTATTTTCACATTT
ACTCAACATCAAAAATTATCCTTAATGAGAAATGTTATTTCTTGGAAGTT
TTCTTGGAAATTAGTTAAACGAAACAATCATTAAATAAGTTTCTTATGTT
TTCATTTTTCCGTGGAATATTTTTTTAATTGACTTAACATAATTTGTTGA
ATGCTACTTAATAATAATACTACTTAATAATTTAAGGAACCTTGATCTGA
TAAAGAAAACACGAATAATACATCTTGGAAATACCGAGACAGCCACAAAA
TAAGCTTATGCATCTAAAGTCAAAGGCTTAGAGATCTATATATAATCGCT
CGCACAAACTGACTTTTCCTTGACATTTGCGAAGGTGTTTTGAACGGATT
AGTCGTGTTTGAAAAGAGACTCCCCTCAGAAGTGCCACCAATAGCGGTTG
CAACATCACAAGTAGCCGCTGTGGGACGCTTTTCCCCTTTATCAGCGATT
CAGCGAGCTGAGCTGAGCATTTCCCCTCAAGTGGCAGCAACCCCAAAAAA
AAAAAAAAAA

RH44958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 649 CG32643-RA 23..649 1..627 3135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12875552..12879185 6..3644 17660 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 306 CG32643-PA 1..306 33..338 1530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 548 CG32643-RA 56..548 1..493 2465 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-PA 101 CG32643-PA 1..101 33..335 521 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12984579..12988235 1..3657 18255 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12992677..12996333 1..3657 18255 99.9 Plus
Blast to na_te.dros performed 2014-11-27 03:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 559..668 470..576 154 64.9 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 6930..7017 1892..1978 131 62.5 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 7016..7075 563..503 131 70.5 Minus

RH44958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:05:53 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12875547..12879185 1..3644 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:08 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:08:46 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:49 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:05:53 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-15 11:27:31 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 23..649 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:08:46 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 23..649 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:49 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 56..548 1..493 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:05:53 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 56..548 1..493 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:05:53 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
X 12984579..12988222 1..3644 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:49 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12878612..12882255 1..3644 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:00:51 Download gff for RH44958.complete
Subject Subject Range Query Range Percent Splice Strand
X 12992677..12996320 1..3644 99   Plus

RH44958.pep Sequence

Translation from 2 to 337

> RH44958.pep
SSASKLLPKIMSSQQKPINVYVPPISSFPEASFLGGYGLQDRIEVPKSAE
VLEDVIDERDAHFLYVVDSQGRLLEHIRYYGDDYRMALREAFTTKVLDQQ
NTGADLPLNRE*

RH44958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21396-PA 138 GF21396-PA 6..87 18..92 287 65.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17747-PA 101 GG17747-PA 1..101 11..111 447 81.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-PA 101 CG32643-PA 1..101 11..111 521 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16286-PA 110 GI16286-PA 1..102 10..93 161 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11594-PA 101 GM11594-PA 1..101 11..111 496 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17095-PA 101 GD17095-PA 1..101 11..111 500 92.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16525-PA 106 GJ16525-PA 1..99 11..94 147 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25186-PA 94 GK25186-PA 1..93 11..95 188 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17037-PA 117 GE17037-PA 1..103 11..111 426 80.6 Plus

RH44958.hyp Sequence

Translation from 2223 to 2759

> RH44958.hyp
MNQFKNKCVLNFCLLKNTFKSCLIAKIGDFGNGKILKIFMEVFNESCICF
VSLKGPFFEESFSPKDWIRRFSTFPLQKTESQKIKKTTTESAESVEPILV
IPRILRQILDAFASGACAECAPGASEMATGCERDGARPTSGVIGVLGWGT
RLKANLLTKCILRIRPIRRTSPTGKPLA*
Sequence RH44958.hyp has no blast hits.