Clone RH50403 Report

Search the DGRC for RH50403

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:504
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG3119-RB
Protein status:RH50403.pep: gold
Sequenced Size:697

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3119-RB 2010-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RH50403.complete Sequence

697 bp assembled on 2010-02-12

GenBank Submission: BT120332.1

> RH50403.complete
GAATCGGGAACCGATCGTCGCGGAGAACACAACGCTCGTGGAGAATGACG
GCCAAGATGAAGCTGCGGTCCCAGCTGCATCTGCTCACTGGTTTCATGGC
TGGATTCGTGCTGGCCTTCGTGCTCCTCCTCTACGTCTACGATGTCAGCA
GGGTGACGCCCTGCTGGAGCAGCACCTCCACCATGACCACGGCCACAACG
GCCAGGATTGAGGATGGTCCACCACCGCGCATTCTGTGCATGGTGCTCAC
CTGTCCGGAGAACGTGCAGAGCCTGGCCAGAAGTGTCTACGAGACCTGGG
GCCAGCGCTGCAGCCGCCTGATCTTCGCCAGCAGCGAGGACTACGAGCCA
CTGGGCGTGGTCGGTGTGGTGGAGCCAACTGGCGGTGGCTACGAGGATCT
GTGGAATAAAACGCGCGAGGGATTCCGACACGTTTGGGAGCACTACGCTG
GCGACTACGATTGGTTCCTCAAGGCAGATGACGATACGTACGTGGTCATG
GAGAATCTGCAGCACCTGCTCCGTGGCTTCGATCCGAATACGCCCGTCTT
CTTTGGCTACAAGATGTCGCGATACAATGTGCTTCTGCATTTTGAATAGA
GTTTATCTGACGGATTGATTATTCCTAATGCATCATAAATGTTTAATGAT
TTGTGATTGATTACAGTGATTATTTCGCACGAAAAAAAAAAAAAAAA

RH50403.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-RB 660 CG3119-RB 1..660 2..661 3300 100 Plus
CG3119-RA 1325 CG3119-RA 135..714 2..581 2900 100 Plus
CG3119.a 1358 CG3119.a 1..580 2..581 2900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2837031..2837518 489..2 2320 98.4 Minus
chr2L 23010047 chr2L 2835766..2835866 681..581 505 100 Minus
chr2L 23010047 chr2L 2836880..2836973 581..488 470 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-RB 555 CG3119-PB 1..555 45..599 2775 100 Plus
CG3119-RA 1068 CG3119-PA 1..537 45..581 2685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-RB 682 CG3119-RB 3..682 2..681 3400 100 Plus
CG3119-RA 1193 CG3119-RA 3..582 2..581 2900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-PB 184 CG3119-PB 1..184 45..596 773 100 Plus
CG3119-PA 355 CG3119-PA 1..179 45..581 746 100 Plus
C1GalTA-PA 388 CG9520-PA 100..213 228..575 287 45.7 Plus
C1GalTA-PC 388 CG9520-PC 100..213 228..575 287 45.7 Plus
C1GalTA-PB 388 CG9520-PB 100..213 228..575 287 45.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2837344..2837831 489..2 2440 100 Minus
2L 23513712 2L 2836078..2836179 682..581 510 100 Minus
2L 23513712 2L 2837193..2837286 581..488 470 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2837344..2837831 489..2 2440 100 Minus
2L 23513712 2L 2836078..2836179 682..581 510 100 Minus
2L 23513712 2L 2837193..2837286 581..488 470 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:07:44 has no hits.

RH50403.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:40:07 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2837033..2837518 1..487 98   Minus
chr2L 2836880..2836973 488..581 100 <- Minus
chr2L 2835766..2835865 582..681 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-12 09:31:31 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..555 45..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:50 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..555 45..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:48 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..555 45..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:40:07 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..555 45..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-12 09:31:31 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..660 2..661 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:50 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..660 2..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:48 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..682 1..681 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:40:07 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
CG3119-RB 1..682 1..681 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:40:07 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2837346..2837831 1..487 99   Minus
2L 2837193..2837286 488..581 100 <- Minus
2L 2836079..2836178 582..681 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:48 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2837346..2837831 1..487 99   Minus
arm_2L 2837193..2837286 488..581 100 <- Minus
arm_2L 2836079..2836178 582..681 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:58 Download gff for RH50403.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2837346..2837831 1..487 99   Minus
2L 2837193..2837286 488..581 100 <- Minus
2L 2836079..2836178 582..681 100 <- Minus

RH50403.pep Sequence

Translation from 2 to 598

> RH50403.pep
IGNRSSRRTQRSWRMTAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSR
VTPCWSSTSTMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWG
QRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAG
DYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVLLHFE*

RH50403.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14916-PA 357 GF14916-PA 1..181 15..193 725 76.8 Plus
Dana\GF15693-PA 390 GF15693-PA 101..214 76..191 322 49.1 Plus
Dana\GF24418-PA 341 GF24418-PA 64..173 76..187 293 48.2 Plus
Dana\GF14913-PA 452 GF14913-PA 105..218 76..191 275 45.7 Plus
Dana\GF14915-PA 342 GF14915-PA 26..182 22..185 268 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24483-PA 357 GG24483-PA 1..181 15..193 824 89.5 Plus
Dere\GG24047-PA 388 GG24047-PA 100..213 76..191 315 47.4 Plus
Dere\GG14745-PA 342 GG14745-PA 63..172 76..187 293 49.1 Plus
Dere\GG10669-PA 453 GG10669-PA 83..211 57..191 289 43.7 Plus
Dere\GG24890-PA 386 GG24890-PA 62..200 62..191 288 41.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25125-PA 372 GH25125-PA 19..198 20..193 612 63.3 Plus
Dgri\GH25080-PA 308 GH25080-PA 90..203 76..191 336 51.7 Plus
Dgri\GH23406-PA 327 GH23406-PA 57..170 76..191 334 51.7 Plus
Dgri\GH25081-PA 695 GH25081-PA 341..515 22..191 333 39.1 Plus
Dgri\GH23497-PA 274 GH23497-PA 1..166 27..189 325 40.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-PB 184 CG3119-PB 1..184 15..198 997 100 Plus
CG3119-PA 355 CG3119-PA 1..179 15..193 970 100 Plus
C1GalTA-PA 388 CG9520-PA 100..213 76..191 317 47.4 Plus
C1GalTA-PC 388 CG9520-PC 100..213 76..191 317 47.4 Plus
C1GalTA-PB 388 CG9520-PB 100..213 76..191 317 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12090-PA 356 GI12090-PA 2..182 19..193 531 56.9 Plus
Dmoj\GI12057-PA 440 GI12057-PA 55..168 76..191 320 49.1 Plus
Dmoj\GI12045-PA 391 GI12045-PA 101..214 76..191 316 48.3 Plus
Dmoj\GI11429-PA 336 GI11429-PA 59..168 76..187 313 51.8 Plus
Dmoj\GI17446-PA 390 GI17446-PA 90..203 76..191 267 44.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25549-PA 390 GL25549-PA 100..213 76..191 319 48.3 Plus
Dper\GL15447-PA 379 GL15447-PA 89..198 76..188 298 50.4 Plus
Dper\GL16899-PA 341 GL16899-PA 66..176 76..188 291 46.9 Plus
Dper\GL26713-PA 452 GL26713-PA 103..216 76..191 278 45.7 Plus
Dper\GL15448-PA 597 GL15448-PA 326..438 76..185 274 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29035-PA 359 GA29035-PA 1..182 15..193 753 73.6 Plus
Dpse\GA21851-PA 390 GA21851-PA 100..213 76..191 319 48.3 Plus
Dpse\GA28803-PA 347 GA28803-PA 89..198 76..188 298 50.4 Plus
Dpse\GA23793-PA 340 GA23793-PA 66..176 76..188 283 46 Plus
Dpse\GA29031-PA 452 GA29031-PA 103..216 76..191 278 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18192-PA 355 GM18192-PA 1..179 15..193 885 96.1 Plus
Dsec\GM12650-PA 379 GM12650-PA 91..204 76..191 315 47.4 Plus
Dsec\GM14363-PA 340 GM14363-PA 63..172 76..187 287 47.3 Plus
Dsec\GM20714-PA 446 GM20714-PA 17..209 18..189 284 36.2 Plus
Dsec\GM18370-PA 383 GM18370-PA 86..202 76..194 283 44.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22798-PA 355 GD22798-PA 1..179 15..193 884 96.1 Plus
Dsim\GD22375-PA 388 GD22375-PA 100..213 76..191 315 47.4 Plus
Dsim\GD13582-PA 333 GD13582-PA 63..172 76..187 291 48.2 Plus
Dsim\GD10181-PA 446 GD10181-PA 17..211 18..191 285 35.9 Plus
Dsim\GD23186-PA 386 GD23186-PA 86..199 76..191 283 45.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14142-PA 370 GJ14142-PA 12..196 20..193 630 61.6 Plus
Dvir\GJ14135-PA 386 GJ14135-PA 101..214 76..191 308 47.4 Plus
Dvir\GJ13625-PA 339 GJ13625-PA 2..170 21..187 294 40.4 Plus
Dvir\GJ14139-PA 441 GJ14139-PA 14..205 20..191 294 34.5 Plus
Dvir\GJ14141-PA 589 GJ14141-PA 321..437 76..191 289 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24756-PA 362 GK24756-PA 1..186 15..193 664 66.1 Plus
Dwil\GK24753-PA 440 GK24753-PA 10..207 11..187 305 35.3 Plus
Dwil\GK14790-PA 390 GK14790-PA 101..214 76..191 303 45.7 Plus
Dwil\GK14791-PA 371 GK14791-PA 101..214 76..191 302 45.7 Plus
Dwil\GK17363-PA 355 GK17363-PA 70..179 76..187 300 51.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15003-PA 355 GE15003-PA 1..179 15..193 895 91.6 Plus
Dyak\GE10709-PA 388 GE10709-PA 100..213 76..191 317 47.4 Plus
Dyak\GE21107-PA 342 GE21107-PA 63..172 76..187 295 48.2 Plus
Dyak\GE18184-PA 385 GE18184-PA 85..198 76..191 286 46.6 Plus
Dyak\GE23251-PA 451 GE23251-PA 98..211 76..191 286 46.6 Plus

RH50403.hyp Sequence

Translation from 2 to 598

> RH50403.hyp
IGNRSSRRTQRSWRMTAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSR
VTPCWSSTSTMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWG
QRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAG
DYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVLLHFE*

RH50403.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3119-PB 184 CG3119-PB 1..184 15..198 997 100 Plus
CG3119-PA 355 CG3119-PA 1..179 15..193 970 100 Plus
C1GalTA-PA 388 CG9520-PA 100..213 76..191 317 47.4 Plus
C1GalTA-PC 388 CG9520-PC 100..213 76..191 317 47.4 Plus
C1GalTA-PB 388 CG9520-PB 100..213 76..191 317 47.4 Plus