Clone RH51274 Report

Search the DGRC for RH51274

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:512
Well:74
Vector:pFlc-1
Associated Gene/TranscriptPop2-RB
Protein status:RH51274.pep: gold
Preliminary Size:1966
Sequenced Size:1802

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5684 2002-10-17 Blastp of sequenced clone
CG5684 2003-01-01 Sim4 clustering to Release 3
Pop2 2008-04-29 Release 5.5 accounting
Pop2 2008-08-15 Release 5.9 accounting
Pop2 2008-12-18 5.12 accounting

Clone Sequence Records

RH51274.complete Sequence

1802 bp (1802 high quality bases) assembled on 2002-10-17

GenBank Submission: BT001837

> RH51274.complete
GACTGCCGCAATCGCGAACAATTTTTTATTATGGCACTTGCGCGGCTCAC
AAACGATATTCGCTGATAAACATTCATTGGAAATTATTGCCGAACGCAGA
GGACTCCGCCAATTGAAGTGTGCGCTTAAAACGATCGCCGTGCAGGAAGC
GGAAGTGCCCCATAACAGCTATTTTCTCGCCGCTTTCTCCCCCATCACCC
CCCCGCAAAACAAGCGACGCCGATAGAAACATTTAATTTGTGCAAATAGC
CGAAACCTACACGGTCGGCCATCAAATATTATGAAATGGGAGCATTGATC
CCCCGAATCAGAGCTTAAGACCACACATCCAGGTGGAACTTGTTGCTTGA
GGCTTGGTTGTAGGTCAGTGCGAAGAGGTGGCTGATCCGGCGGCGAAGGG
TGCGCACCAGGCGACGTCCGGCGACGATACAATGCCCTCGGCCATCAGTG
GCGCGCCACATGCCCACATACCCAGCAACGAGGAGTGCGGCATCCGCGAT
GTGTGGAAGCAAAACCTGGAGGAGGAGTTCCGCACCATACGGAAAGTGGT
GCAGAAGTACCACTATGTGGCCATGGACACCGAGTTTCCAGGCGTGGTAG
CACGTCCAGTCGGCGAGTTCCGCTCCACGGCGGACTATCATTACCAGCTG
CTGCGCTGTAATGTCGATCTGCTGCGGATTATCCAATTGGGCCTTACCTT
CATGGACGACGATGGAAAGACACCACCCGGCTACTCCACCTGGCAGTTCA
ACTTCAAGTTTAACCTGAGCGAGGACATGTATGCGCAGGACTCGATCGAT
CTGCTGCAGAACTCCGGAATTCAGTTCAAGAAGCACGAGGAGGATGGCAT
CGATCCCATCGACTTCGCCGAACTGCTGATGAGCTCTGGCATCGTGCTGG
TGGAAAACATCAAGTGGCTGTGCTTCCACTCCGGCTACGATTTTGGCTAC
CTTCTAAAGCTGCTCACCGATCAGAACCTGCCCCCGGACGAATCTGAATT
TTTCGATCTGCTGCACATCTACTTTCCCAACATCTTCGACATCAAGTATC
TGATGAAGTCGTGCAAGAACCTGAAAGGCGGCCTGCAGGAGGTTGCCGAT
CAGCTGGAACTGCGGCGCGTGGGCCCCCAGCATCAGGCCGGCTCGGATGC
TCTGCTGACGGGCATGGCCTTCTTCAAAATGCGTGAGATGTTCTTCGAGG
ACAACATCGACCATGCGAAGTACTCCGGACACCTGTACGGCCTGGGTACC
TCCTTCATCGTCAATGGCACCAACTTCCACGACAGCAACGGTGAGACGAA
CAGCGCTTCATGATTCGTACTGATGGGGAACGTGGTCGTGCACGACAGGA
AGTTCGAGCAGGAGGAATCACCGGGTCCGTCGGCATCTGTGCAGGCCACA
CCACCTGGCCAACTGATCCTAGCCGTAACAACACCATTGCAGTAATCTGT
GGACAGTCGACACAGATCGTTCCCATTTGTGAACAATTATACCCCGTTGG
CCATAAAGCTAACTTCTTGATGTTTCCCACGCAAATTCAGATGAATAGGC
AACCGTTCAATACGAAAACATGGCATAAACTAATTGTAAATCGCATAGAA
ATGAAAAACCGGCAAAACTAAAATAGATTCAATTTCAAGTTCTGCATGTC
TTAAATGTGTTACGAATACAAAACTAAGGTATGTAAAATTAAGCTAAAAC
TGTAAGCCAATGAGCGAAACAGAGAATATTGTGTATTTGTAAAAAGAGCA
AAAAAACAATATATTTAAAACTTTTTAATTTAGTGTAAAAAAAAAAAAAA
AA

RH51274.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RC 1866 Pop2-RC 78..1863 2..1787 8915 99.9 Plus
Pop2-RB 1895 Pop2-RB 394..1892 289..1787 7480 99.9 Plus
Pop2.a 1949 Pop2.a 448..1946 289..1787 7480 99.9 Plus
Pop2-RB 1895 Pop2-RB 41..333 2..294 1450 99.6 Plus
Pop2.a 1949 Pop2.a 30..317 2..289 1440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11989201..11989801 1786..1186 2960 99.5 Minus
chr3L 24539361 chr3L 11991076..11991495 1187..768 2100 100 Minus
chr3L 24539361 chr3L 11991553..11991893 769..429 1705 100 Minus
chr3L 24539361 chr3L 11993385..11993673 290..2 1430 99.7 Minus
chr3L 24539361 chr3L 11992530..11992669 428..289 700 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RA 894 CG5684-PA 10..894 429..1313 4425 100 Plus
Pop2-RB 882 CG5684-PB 1..882 432..1313 4410 100 Plus
Pop2-RC 882 CG5684-PC 1..882 432..1313 4410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RC 1827 CG5684-RC 43..1827 2..1786 8910 99.9 Plus
Pop2-RB 1893 CG5684-RB 396..1893 289..1786 7475 99.9 Plus
Pop2-RA 1688 CG5684-RA 331..1688 429..1786 6775 99.9 Plus
Pop2-RB 1893 CG5684-RB 43..335 2..294 1450 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-PA 297 CG5684-PA 4..297 429..1310 1573 100 Plus
Pop2-PB 293 CG5684-PB 1..293 432..1310 1568 100 Plus
Pop2-PC 293 CG5684-PC 1..293 432..1310 1568 100 Plus
Pop2-PE 361 CG5684-PE 4..257 429..1190 1351 99.6 Plus
Pop2-PD 357 CG5684-PD 1..253 432..1190 1346 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11998397..11998998 1787..1186 2995 99.8 Minus
3L 28110227 3L 12000273..12000692 1187..768 2100 100 Minus
3L 28110227 3L 12000750..12001090 769..429 1705 100 Minus
3L 28110227 3L 12002585..12002873 290..2 1445 100 Minus
3L 28110227 3L 12001727..12001866 428..289 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11991497..11992098 1787..1186 2995 99.8 Minus
3L 28103327 3L 11993373..11993792 1187..768 2100 100 Minus
3L 28103327 3L 11993850..11994190 769..429 1705 100 Minus
3L 28103327 3L 11995685..11995973 290..2 1445 100 Minus
3L 28103327 3L 11994827..11994966 428..289 700 100 Minus
Blast to na_te.dros performed 2014-11-27 03:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 1464..1580 1701..1578 125 61.6 Minus
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 151..197 1578..1624 118 72.3 Plus

RH51274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:58:12 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11993386..11993673 1..289 99   Minus
chr3L 11992530..11992668 290..428 100 <- Minus
chr3L 11991553..11991893 429..769 100 <- Minus
chr3L 11991076..11991493 770..1187 100 <- Minus
chr3L 11989201..11989799 1188..1786 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:00 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RA 10..894 429..1313 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:10:28 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RA 10..894 429..1313 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:06:46 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RA 10..894 429..1313 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:21 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RA 10..894 429..1313 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:58:12 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RA 10..894 429..1313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:31:48 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 40..1825 1..1786 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:10:28 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 40..1825 1..1786 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:06:46 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 42..1827 1..1786 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:21 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 40..1825 1..1786 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:58:12 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 42..1827 1..1786 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:58:12 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12002586..12002873 1..289 99   Minus
3L 12001727..12001865 290..428 100 <- Minus
3L 12000750..12001090 429..769 100 <- Minus
3L 12000273..12000690 770..1187 100 <- Minus
3L 11998398..11998996 1188..1786 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:06:46 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11995686..11995973 1..289 99   Minus
arm_3L 11994827..11994965 290..428 100 <- Minus
arm_3L 11993850..11994190 429..769 100 <- Minus
arm_3L 11993373..11993790 770..1187 100 <- Minus
arm_3L 11991498..11992096 1188..1786 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:32:57 Download gff for RH51274.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11995686..11995973 1..289 99   Minus
3L 11994827..11994965 290..428 100 <- Minus
3L 11993850..11994190 429..769 100 <- Minus
3L 11993373..11993790 770..1187 100 <- Minus
3L 11991498..11992096 1188..1786 99 <- Minus

RH51274.pep Sequence

Translation from 431 to 1312

> RH51274.pep
MPSAISGAPHAHIPSNEECGIRDVWKQNLEEEFRTIRKVVQKYHYVAMDT
EFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPPG
YSTWQFNFKFNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPIDFAELLM
SSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPN
IFDIKYLMKSCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKM
REMFFEDNIDHAKYSGHLYGLGTSFIVNGTNFHDSNGETNSAS*

RH51274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 02:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10398-PA 296 GF10398-PA 2..296 1..293 1518 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 02:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13860-PA 297 GG13860-PA 5..297 1..293 1543 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 02:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16922-PA 324 GH16922-PA 30..324 1..293 1510 94.6 Plus
Dgri\GH12756-PA 265 GH12756-PA 5..244 14..253 1064 82.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-PB 293 CG5684-PB 1..293 1..293 1568 100 Plus
Pop2-PC 293 CG5684-PC 1..293 1..293 1568 100 Plus
Pop2-PA 297 CG5684-PA 5..297 1..293 1568 100 Plus
Pop2-PD 357 CG5684-PD 1..253 1..253 1346 99.6 Plus
Pop2-PE 361 CG5684-PE 5..257 1..253 1346 99.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 02:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13677-PA 324 GI13677-PA 30..324 1..293 1522 95.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 02:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17886-PA 295 GL17886-PA 1..295 1..293 1514 95.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 02:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19054-PA 295 GA19054-PA 1..295 1..293 1514 95.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 02:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24684-PA 38 GM24684-PA 1..38 245..293 173 75.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 02:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12753-PA 152 GD12753-PA 5..137 1..133 730 100 Plus
Dsim\GD12039-PA 208 GD12039-PA 1..117 150..267 560 89.8 Plus
Dsim\GD12754-PA 220 GD12754-PA 1..104 150..253 558 99 Plus
Dsim\GD12754-PA 220 GD12754-PA 180..220 253..293 213 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 02:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14014-PA 324 GJ14014-PA 30..324 1..293 1512 94.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 02:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17222-PA 295 GK17222-PA 1..295 1..293 1507 94.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 02:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20153-PA 297 GE20153-PA 5..297 1..293 1543 97.3 Plus

RH51274.hyp Sequence

Translation from 431 to 1312

> RH51274.hyp
MPSAISGAPHAHIPSNEECGIRDVWKQNLEEEFRTIRKVVQKYHYVAMDT
EFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPPG
YSTWQFNFKFNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPIDFAELLM
SSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPN
IFDIKYLMKSCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKM
REMFFEDNIDHAKYSGHLYGLGTSFIVNGTNFHDSNGETNSAS*

RH51274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-PB 293 CG5684-PB 1..293 1..293 1568 100 Plus
Pop2-PC 293 CG5684-PC 1..293 1..293 1568 100 Plus
Pop2-PA 297 CG5684-PA 5..297 1..293 1568 100 Plus
Pop2-PD 357 CG5684-PD 1..253 1..253 1346 99.6 Plus
Pop2-PE 361 CG5684-PE 5..257 1..253 1346 99.6 Plus