Clone RH52721 Report

Search the DGRC for RH52721

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:527
Well:21
Vector:pFlc-1
Associated Gene/TranscriptTpr2-RB
Protein status:RH52721.pep: gold
Sequenced Size:2122

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tpr2-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH52721.complete Sequence

2122 bp assembled on 2009-10-14

GenBank Submission: BT100099.1

> RH52721.complete
GACTCAGTCGCGAGTTGCAGCAGTGCGTCGATCGACGTCGTTTTCCGTGC
TAGTCGCGAAAATTGTGAAAAAATTGTGTCGCGAAAAGGGAAATTTACTG
AATCAATAGGAAAACAAAGGCTCCAAGAATTTTCGCTTTGAGTTGTTTGT
CTCCTTTGCTGTGTCAAATAATGAAAATAATACGATAATATTGTGATGAT
CAAAACGTGTCTTAAATCGAAATCAAATAATTATTCCAAAATAAGTGAAC
ATAGACGACACATACATCAAGCGATCCAGTCCGTATCTATGTGCTCGCAA
ATAGCCCACTTCGACCAGACGGAATAGCCAACTAAATCTTTGTAAATCCA
CAACGAGCCAACAATCGAGCTGAATAAAATGTTGTACATTGCCGAGGAGA
AGAAGAAACTGGGCAACGACCAATACAAGGCGCAGAACTATCAGAATGCA
CTCAAGCTCTACACGGATGCCATATCGCTGTGTCCGGACTCGGCGGCATA
CTATGGCAATCGGGCCGCCTGCTACATGATGCTGCTCAACTATAATAGCG
CCCTGACCGACGCCCGACACGCCATACGCATCGATCCGGGCTTCGAGAAG
GCCTACGTCCGTGTGGCCAAGTGCTGTCTGGCCCTGGGCGACATTATTGG
CACCGAACAGGCCGTCAAAATGGTCAACGAGCTGAATTCGCTTAGCACGG
CTGTTGCTGCCGAACAGACGGCGGCGCAAAAGTTGCGCCAATTGGAGGCC
ACCATTCAGGCGAACTACGATACGAAATCCTATCGCAATGTGGTCTTCTA
TTTGGATAGTGCCTTGAAATTGGCGCCCGCCTGTTTGAAATATCGTCTAC
TCAAGGCTGAGTGCCTTGCATTTTTGGGGCGATGTGATGAGGCCTTGGAC
ATTGCGGTCAGTGTAATGAAACTGGATACCACATCGGCGGATGCGATATA
CGTGAGAGGTCTGTGCCTGTACTACACGGACAACCTGGACAAGGGAATTC
TTCATTTCGAGCGCGCCCTGACCCTCGACCCGGACCACTACAAGTCCAAG
CAGATGCGCAGCAAATGCAAGCAGCTCAAGGAGATGAAGGAGAACGGCAA
TATGCTATTCAAGTCGGGTCGGTATCGCGAGGCACACGTTATCTACACGG
ACGCCCTGAAGATCGATGAACACAACAAGGATATCAATTCGAAATTGCTT
TACAATCGGGCTTTGGTCAACACGCGTATTGGCAATTTGCGAGAGGCCGT
GGCCGATTGCAATCGAGTGCTGGAGCTGAATAGTCAGTATCTGAAGGCTC
TGTTGCTGCGAGCGCGCTGCTACAATGATCTGGAGAAGTTCGAGGAGTCG
GTGGCGGACTATGAGACGGCGCTGCAGCTGGAGAAGACGCCGGAGATTAA
GCGAATGCTGCGCGAGGCCAAGTTTGCGTTGAAGAAGTCGAAGCGAAAGG
ACTACTACAAGATCCTGGGCATTGGACGCAATGCGTCCGACGACGAGATC
AAGAAGGCGTATCGCAAAAAGGCGCTGGTACATCATCCGGATCGACACGC
AAACAGCAGTGCCGAGGAGCGCAAGGAGGAGGAGCTCAAGTTCAAGGAGG
TGGGCGAGGCGTACGCCATACTGTCGGATGCTCACAAGAAGTCGCGCTAC
GACAGCGGCCAGGATATCGAGGAGCAGGAGCAAGCCGACTTCGATCCGAA
TCAAATGTTCCGCACATTCTTCCAATTCAACGGCGGTGGCCGGAATAATT
CATCGTTCAACTTTGAGTTCTAGGATCCCAACGAGTGTTGTTCACCACCA
CAGAGAAGAAGACCATCTCAATCCCATACTTTCTGCCTCATCCGAAACCA
ACATACAGCAGCGCACAAATTTTGAACTCTTTTACATATTTCTTTTCCAA
AAAGCAAGAAAATACCACATTTTGATTATGTTAACGAATGAATATATGCC
AAGTTATTTGAAAAAATATTCTAAATCAAAATAATGCAACTAAATTTCCA
GTGTAAGTTCACATTTTTAAATGTTCTTTCTTGGATTTTTTTTACGGCAA
CATTAATAAATCATGGGAGATTTGTGTTAAATAAACAGAAATATACATAT
AAAAATAAAAAAAAAAAAAAAA

RH52721.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2.d 2419 Tpr2.d 41..2150 2..2111 10520 99.9 Plus
Tpr2-RB 2147 Tpr2-RB 41..2146 2..2107 10515 99.9 Plus
Tpr2.e 2628 Tpr2.e 502..2367 246..2111 9300 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16504806..16505650 840..1684 4180 99.6 Plus
chr2L 23010047 chr2L 16504294..16504746 387..839 2265 100 Plus
chr2L 23010047 chr2L 16505725..16506148 1683..2106 2060 99.1 Plus
chr2L 23010047 chr2L 16495595..16495979 2..386 1895 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-RE 1395 CG4599-PE 1..1395 379..1773 6975 100 Plus
Tpr2-RB 1395 CG4599-PB 1..1395 379..1773 6975 100 Plus
Tpr2-RD 1527 CG4599-PD 141..1527 387..1773 6935 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-RB 2103 CG4599-RB 1..2103 4..2106 10500 100 Plus
Tpr2-RE 2373 CG4599-RE 513..2373 246..2106 9290 99.9 Plus
Tpr2-RD 2503 CG4599-RD 513..2232 387..2106 8585 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-PE 464 CG4599-PE 1..443 379..1707 2200 100 Plus
Tpr2-PB 464 CG4599-PB 1..443 379..1707 2200 100 Plus
Tpr2-PD 508 CG4599-PD 48..487 388..1707 2184 100 Plus
Tpr2-PC 478 CG4599-PC 18..457 388..1707 2184 100 Plus
Tpr2-PA 508 CG4599-PA 48..487 388..1707 2184 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16506008..16506852 840..1684 4225 100 Plus
2L 23513712 2L 16505496..16505948 387..839 2265 100 Plus
2L 23513712 2L 16506927..16507355 1683..2111 2115 99.5 Plus
2L 23513712 2L 16496767..16497151 2..386 1925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16506008..16506852 840..1684 4225 100 Plus
2L 23513712 2L 16505496..16505948 387..839 2265 100 Plus
2L 23513712 2L 16506927..16507355 1683..2111 2115 99.5 Plus
2L 23513712 2L 16496767..16497151 2..386 1925 100 Plus
Blast to na_te.dros performed 2014-11-27 09:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
G4 3856 G4 G4_DM 3856bp 2495..2647 1836..1991 124 56.1 Plus
looper1 1881 looper1 LOOPER1_DM 1881bp 206..314 147..256 123 60.4 Plus

RH52721.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:27:04 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16505727..16506148 1685..2106 99   Plus
chr2L 16504806..16505650 840..1684 99 -> Plus
chr2L 16504294..16504746 387..839 100 -> Plus
chr2L 16495594..16495979 1..386 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:15:51 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..1395 379..1773 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:55 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..1395 379..1773 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:32:22 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..1395 379..1773 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:04 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..1395 379..1773 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:15:51 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 2..2106 2..2106 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:55 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 2..2106 2..2106 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:32:22 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..2103 4..2106 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:04 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 1..2103 4..2106 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:04 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16506929..16507350 1685..2106 99   Plus
2L 16506008..16506852 840..1684 100 -> Plus
2L 16505496..16505948 387..839 100 -> Plus
2L 16496766..16497151 1..386 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:32:22 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16506929..16507350 1685..2106 99   Plus
arm_2L 16506008..16506852 840..1684 100 -> Plus
arm_2L 16505496..16505948 387..839 100 -> Plus
arm_2L 16496766..16497151 1..386 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:28 Download gff for RH52721.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16506929..16507350 1685..2106 99   Plus
2L 16506008..16506852 840..1684 100 -> Plus
2L 16505496..16505948 387..839 100 -> Plus
2L 16496766..16497151 1..386 99 -> Plus

RH52721.pep Sequence

Translation from 378 to 1772

> RH52721.pep
MLYIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYM
MLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVN
ELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAP
ACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYT
DNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYR
EAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLEL
NSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFA
LKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKE
EELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQADFDPNQMFRTFFQF
NGGGRNNSSFNFEF*

RH52721.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13997-PA 521 GF13997-PA 62..521 4..464 2331 94.8 Plus
Dana\GF18482-PA 498 GF18482-PA 48..495 10..464 239 23.9 Plus
Dana\GF19555-PA 334 GF19555-PA 3..65 357..425 208 62.3 Plus
Dana\GF10450-PA 354 GF10450-PA 3..119 357..456 198 43.9 Plus
Dana\GF15175-PA 346 GF15175-PA 3..70 357..429 185 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22751-PA 508 GG22751-PA 49..508 4..464 2373 96.7 Plus
Dere\GG16950-PA 496 GG16950-PA 83..493 45..464 245 23.7 Plus
Dere\GG18918-PA 332 GG18918-PA 3..98 357..464 215 46.3 Plus
Dere\DnaJ-1-PA 351 GG14117-PA 3..70 357..429 194 56.8 Plus
Dere\GG24779-PA 350 GG24779-PA 3..70 357..429 186 55.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25192-PA 501 GH25192-PA 43..501 4..464 2143 86.8 Plus
Dgri\GH23190-PA 309 GH23190-PA 1..309 154..464 1466 88.1 Plus
Dgri\GH18284-PA 498 GH18284-PA 49..495 10..464 249 23.5 Plus
Dgri\GH11404-PA 346 GH11404-PA 3..91 357..464 197 45.9 Plus
Dgri\GH15011-PA 353 GH15011-PA 3..70 357..429 191 54.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-PE 464 CG4599-PE 1..464 1..464 2389 100 Plus
Tpr2-PB 464 CG4599-PB 1..464 1..464 2389 100 Plus
Tpr2-PD 508 CG4599-PD 48..508 4..464 2373 100 Plus
Tpr2-PC 478 CG4599-PC 18..478 4..464 2373 100 Plus
Tpr2-PA 508 CG4599-PA 48..508 4..464 2373 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17261-PA 499 GI17261-PA 41..499 4..464 2167 87 Plus
Dmoj\GI24092-PA 498 GI24092-PA 49..495 10..464 259 25.4 Plus
Dmoj\GI15199-PA 325 GI15199-PA 3..97 357..455 208 50.5 Plus
Dmoj\GI13174-PA 352 GI13174-PA 3..70 357..429 195 55.4 Plus
Dmoj\GI14539-PA 347 GI14539-PA 3..65 357..425 193 59.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19640-PA 533 GL19640-PA 75..533 4..464 2213 89.8 Plus
Dper\GL19641-PA 498 GL19641-PA 62..492 4..436 1689 75.5 Plus
Dper\GL14339-PA 454 GL14339-PA 6..443 4..448 1198 55.1 Plus
Dper\GL21656-PA 496 GL21656-PA 83..493 45..464 230 23.5 Plus
Dper\GL20776-PA 230 GL20776-PA 3..120 357..456 194 41.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18289-PA 503 GA18289-PA 45..503 4..464 2215 90 Plus
Dpse\GA26041-PA 498 GA26041-PA 62..492 4..436 1669 74.4 Plus
Dpse\GA22978-PA 454 GA22978-PA 6..443 4..448 1210 55.5 Plus
Dpse\GA20956-PA 496 GA20956-PA 83..493 45..464 230 23.5 Plus
Dpse\GA10408-PA 353 GA10408-PA 3..105 357..448 200 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17182-PA 372 GM17182-PA 48..370 4..326 1693 98.8 Plus
Dsec\GM17183-PA 87 GM17183-PA 1..87 378..464 455 96.6 Plus
Dsec\GM23820-PA 492 GM23820-PA 77..489 45..464 234 23.3 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 3..70 357..429 198 58.1 Plus
Dsec\GM16806-PA 350 GM16806-PA 3..70 357..429 191 56.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24060-PA 508 GD24060-PA 48..508 4..464 2414 98 Plus
Dsim\GD18630-PA 498 GD18630-PA 83..495 45..464 235 23.3 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 3..70 357..429 200 58.1 Plus
Dsim\GD23083-PA 346 GD23083-PA 3..70 357..429 191 56.8 Plus
Dsim\GD12075-PA 128 GD12075-PA 3..82 357..444 171 46.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22670-PA 499 GJ22670-PA 41..499 4..464 2194 88.5 Plus
Dvir\GJ10911-PA 498 GJ10911-PA 49..495 10..464 241 26.2 Plus
Dvir\GJ14805-PA 325 GJ14805-PA 3..70 357..429 203 60.8 Plus
Dvir\GJ11949-PA 351 GJ11949-PA 3..65 357..425 192 56.5 Plus
Dvir\GJ16971-PA 347 GJ16971-PA 3..70 357..429 190 56.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24713-PA 500 GK24713-PA 45..500 4..462 2153 87.6 Plus
Dwil\GK14476-PA 497 GK14476-PA 48..494 10..464 241 23.9 Plus
Dwil\GK19767-PA 330 GK19767-PA 3..109 357..450 192 45.1 Plus
Dwil\GK16875-PA 356 GK16875-PA 3..65 357..425 192 56.5 Plus
Dwil\GK15183-PA 346 GK15183-PA 3..91 357..464 188 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12746-PA 504 GE12746-PA 51..504 4..464 2233 92.2 Plus
Dyak\GE25967-PA 498 GE25967-PA 83..495 45..464 218 23.1 Plus
Dyak\DnaJ-1-PA 351 GE20542-PA 3..104 357..448 193 44.4 Plus
Dyak\GE17451-PA 350 GE17451-PA 3..70 357..429 186 55.4 Plus
Dyak\GE22992-PA 127 GE22992-PA 3..70 357..429 169 50 Plus

RH52721.hyp Sequence

Translation from 378 to 1772

> RH52721.hyp
MLYIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYM
MLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVN
ELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAP
ACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYT
DNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYR
EAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLEL
NSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFA
LKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKE
EELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQADFDPNQMFRTFFQF
NGGGRNNSSFNFEF*

RH52721.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-PE 464 CG4599-PE 1..464 1..464 2389 100 Plus
Tpr2-PB 464 CG4599-PB 1..464 1..464 2389 100 Plus
Tpr2-PD 508 CG4599-PD 48..508 4..464 2373 100 Plus
Tpr2-PC 478 CG4599-PC 18..478 4..464 2373 100 Plus
Tpr2-PA 508 CG4599-PA 48..508 4..464 2373 100 Plus