Clone RH52922 Report

Search the DGRC for RH52922

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:529
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG43693-RD
Protein status:RH52922.pep: gold
Sequenced Size:2215

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6327-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH52922.complete Sequence

2215 bp assembled on 2009-10-16

GenBank Submission: BT100117.1

> RH52922.complete
GAGTTGGTCCCGACTTGGCCAGGGTGAAAGGTTCGTCGTGGTGGTGCAAG
GTGCAAGGTCTGCCGGTTTCATCGACAAATCCGCAACTGCCATGTCGACG
CCAGAGAACAAAATCCCGACGGTCACTGCGGGCTACGGAGAAAACGAGAA
GCCCAAAGGCGGCAAAGGCGGGCAATCCAAGTTCATACGTTCGGACATGG
CCGACGTACCCGTGCAGCAGGCGGCAGGATCGACGCTTCCGTTGGTAATC
TCTCGGAAAAAAGGCGACGACTCCGAGGATGGCAACTACAATCCGTTCGA
GCACCGCAAGGTGGAGCATCCGACATCGGATCTCGAGACATTTGTACACT
TGCTAAAGGGATCGCTTGGCTCCGGAATATTGGCCATGCCAATGGCCTTC
TCCCACGCTGGATTGTGGTTCGGTTTGGTGGCCACCTTCGCGGTGGGCAC
CTTGTGCACCTACTGCGTCCACATTCTGGTCAAGTGCGCCCACATCCTGT
GCCGACGTCGTAAAATCCCGATGATGGGATTCGCCGATGTGGCGGAACAG
GCTTTCCTCGACGGACCACCTGCCCTGAATCGCTGGTCACGCTTCATCCG
GTTCATGGTCAATACGTTTCTGGTTATCGATTTGCTGGGCTGCTGCTGCA
TCTATCTGGTTTTCGTGGCCACCAATGTGGAGCAGGTCGTGCGGGTGTAT
ATGGAAACGGAGCTGAGCATTAGAGTTTGGATCATGATCGTGACGGCACC
GCTAATCTTTATGTGCCTGGTACGCAACCTGAAGTTCCTCACGCCCTTCT
CGATGATAGCCAACATCCTGATGTTCGTGGGCATCGTGATCACCTTCATC
TATATGTTCTCCGATATTCCTGCACCCGTGGAACGTCCTGGAATTGTGAG
TGTAACCGAATGGCCATTGTTCTTCGGCACCGTGATCTTTGCTCTGGAGG
GCATCGGTGTAGTTATGTCCCTGGAGAACGACATGAAGAACCCCAGCCAC
TTCATCGGTTGCCCATCTGTCCTGAACTTCGGCATGGGTCTGGTGATTGC
CCTCTACACTCTGGTTGGATTCTTTGGCTTCCTGAAGTACGGCCCGGAAA
CCCAGGCCAGCATTACGCTGAATCTGCCCCTGGAGGATAAGTTGGCCCAA
TCCGTCAAGTTGATGATTGCCATCGCCATCTTCTTCACCTTCACCCTGCA
GTTCTACGTGCCCGTCACGATTTTGTGGAAGGGTCTGGAGCACAAGATCC
GGCCGGAGAAGCAGAACATCAGTGAATACGGACTTCGTGTCTTTCTGGTG
CTTCTGTGCGGCGGAATCGCAGTGGCTCTGCCCAACTTGGGACCTTTCAT
CTCGCTAATTGGAGCGGTGTGCCTGAGTACGCTGGGCATGATCGTTCCGG
CGACCATTGAGCTGGCCGTGTATCATGAGGATCCCGGATACGGGCGCTTC
AATTGGCGGCTGTGGAAGAACTCCGGACTGATACTGTTCGGCGTGGTGGG
TTTCGTGGCCGGAACCTATGTCAGCATCATCGAATTCCACGCCGAATTCA
GCAGCGGTCACTGAGAGATACTGCTAATCTAATTTAACGTAGTCTTTAAT
GAAACTCTTCTAAGCACAGGGATGTCTAAGTTAAGTTTTTAACTAATTTT
AGGGCTAACCAAAGTTTTCTAGGACTCCGAAACCTCCCGCCTCGCCCCCT
GGTTATCCTATCCCGCCCCATCCTTTCCAACTCGATCCGCCACGATCCCT
GATATATATATATATATATATCTATATATATGTATCCACATCCATAACCC
CCATAGGGGGGTATCAGCAATCAAACAACAAAAGTATTTCGATTTAGTCG
GTGCCACGCCCTCAAGGAGTTGCGGCGGTGCGAAGGGGGCGTGGCATTAA
GGTTACTTAGAGAATTCTTGTAGAAGTGATTTTGTATCGTAGTGATTTTG
ACAACAACTTAGTCGTAATTAGTTCCTACTCGAACTAAGCTAAAACAGAC
GGACGCAGCTGAAGTTTGTTTTCGTTCTTCAATTATTTTGTTTTATCATT
GATTTACTCTGTACATTATCGACGCCCTAATTCAATAATCATGACATATT
ACCAATTACACAAATAACCGCTGTCACCTTTAAAGGGGCAGCAAAAAAAT
GGCATTAAAAAAAATAATAAAACTTTTTGAAACAAAAAAAAAAAAAAAAG
AAAAAAAAAAAAAAA

RH52922.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6327-RD 2299 CG6327-RD 113..2296 2..2185 10920 100 Plus
CG6327.d 2176 CG6327.d 99..2174 110..2185 10380 100 Plus
CG6327.e 2869 CG6327.e 789..2864 110..2185 10380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11027253..11028137 2185..1300 4335 99.5 Minus
chr3L 24539361 chr3L 11028512..11029326 1142..328 4075 100 Minus
chr3L 24539361 chr3L 11028288..11028447 1300..1141 800 100 Minus
chr3L 24539361 chr3L 11030509..11030656 328..181 695 98 Minus
chr3L 24539361 chr3L 11042153..11042260 109..2 525 99.1 Minus
chr3L 24539361 chr3L 11030888..11030960 182..110 365 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RD 1473 CG43693-PD 1..1473 92..1564 7365 100 Plus
CG43693-RG 1719 CG43693-PG 265..1719 110..1564 7275 100 Plus
CG43693-RB 1509 CG43693-PB 55..1509 110..1564 7275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RD 2188 CG43693-RD 3..2186 2..2185 10920 100 Plus
CG43693-RG 2434 CG43693-RG 357..2432 110..2185 10380 100 Plus
CG43693-RB 2399 CG43693-RB 322..2397 110..2185 10380 100 Plus
CG43693-RG 2434 CG43693-RG 3..110 2..109 540 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PD 490 CG43693-PD 1..490 92..1561 2467 100 Plus
CG43693-PE 499 CG43693-PE 6..499 71..1561 2440 98.4 Plus
CG43693-PG 572 CG43693-PG 84..572 95..1561 2439 99.2 Plus
CG43693-PB 502 CG43693-PB 7..502 74..1561 2438 98 Plus
CG43693-PA 502 CG43693-PA 7..502 74..1561 2438 98 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11036360..11037245 2185..1300 4430 100 Minus
3L 28110227 3L 11037620..11038434 1142..328 4075 100 Minus
3L 28110227 3L 11037396..11037555 1300..1141 800 100 Minus
3L 28110227 3L 11039617..11039764 328..181 740 100 Minus
3L 28110227 3L 11051262..11051369 109..2 540 100 Minus
3L 28110227 3L 11039996..11040068 182..110 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11029460..11030345 2185..1300 4430 100 Minus
3L 28103327 3L 11030720..11031534 1142..328 4075 100 Minus
3L 28103327 3L 11030496..11030655 1300..1141 800 100 Minus
3L 28103327 3L 11032717..11032864 328..181 740 100 Minus
3L 28103327 3L 11044362..11044469 109..2 540 100 Minus
3L 28103327 3L 11033096..11033168 182..110 365 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:39:16 has no hits.

RH52922.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:47:16 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11042153..11042260 1..109 98   Minus
chr3L 11030890..11030960 110..180 100 <- Minus
chr3L 11030510..11030656 181..327 97 <- Minus
chr3L 11028514..11029326 328..1140 100 <- Minus
chr3L 11028288..11028447 1141..1300 100 <- Minus
chr3L 11027255..11028136 1301..2183 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:16:07 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RD 1..1473 92..1564 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:30 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RD 1..1473 92..1564 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:40:33 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 1..1473 92..1564 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:47:16 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 1..1473 92..1564 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:16:06 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RD 1..2182 2..2183 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:29 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RD 1..2182 2..2183 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:40:33 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 2..2184 1..2183 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:47:16 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 2..2184 1..2183 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:47:16 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11051262..11051369 1..109 99   Minus
3L 11039998..11040068 110..180 100 <- Minus
3L 11039618..11039764 181..327 100 <- Minus
3L 11037622..11038434 328..1140 100 <- Minus
3L 11037396..11037555 1141..1300 100 <- Minus
3L 11036362..11037244 1301..2183 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:40:33 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11044362..11044469 1..109 99   Minus
arm_3L 11033098..11033168 110..180 100 <- Minus
arm_3L 11032718..11032864 181..327 100 <- Minus
arm_3L 11030722..11031534 328..1140 100 <- Minus
arm_3L 11030496..11030655 1141..1300 100 <- Minus
arm_3L 11029462..11030344 1301..2183 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:51 Download gff for RH52922.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11044362..11044469 1..109 99   Minus
3L 11033098..11033168 110..180 100 <- Minus
3L 11032718..11032864 181..327 100 <- Minus
3L 11030722..11031534 328..1140 100 <- Minus
3L 11030496..11030655 1141..1300 100 <- Minus
3L 11029462..11030344 1301..2183 100 <- Minus

RH52922.hyp Sequence

Translation from 0 to 1563

> RH52922.hyp
SWSRLGQGERFVVVVQGARSAGFIDKSATAMSTPENKIPTVTAGYGENEK
PKGGKGGQSKFIRSDMADVPVQQAAGSTLPLVISRKKGDDSEDGNYNPFE
HRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGLWFGLVATFAVGT
LCTYCVHILVKCAHILCRRRKIPMMGFADVAEQAFLDGPPALNRWSRFIR
FMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETELSIRVWIMIVTAP
LIFMCLVRNLKFLTPFSMIANILMFVGIVITFIYMFSDIPAPVERPGIVS
VTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCPSVLNFGMGLVIA
LYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLMIAIAIFFTFTLQ
FYVPVTILWKGLEHKIRPEKQNISEYGLRVFLVLLCGGIAVALPNLGPFI
SLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRLWKNSGLILFGVVG
FVAGTYVSIIEFHAEFSSGH*

RH52922.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PD 490 CG43693-PD 1..490 31..520 2562 100 Plus
CG43693-PE 499 CG43693-PE 6..499 24..520 2535 98.4 Plus
CG43693-PG 572 CG43693-PG 84..572 32..520 2534 99.2 Plus
CG43693-PB 502 CG43693-PB 7..502 25..520 2533 98 Plus
CG43693-PA 502 CG43693-PA 7..502 25..520 2533 98 Plus

RH52922.pep Sequence

Translation from 1 to 1563

> RH52922.pep
SWSRLGQGERFVVVVQGARSAGFIDKSATAMSTPENKIPTVTAGYGENEK
PKGGKGGQSKFIRSDMADVPVQQAAGSTLPLVISRKKGDDSEDGNYNPFE
HRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGLWFGLVATFAVGT
LCTYCVHILVKCAHILCRRRKIPMMGFADVAEQAFLDGPPALNRWSRFIR
FMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETELSIRVWIMIVTAP
LIFMCLVRNLKFLTPFSMIANILMFVGIVITFIYMFSDIPAPVERPGIVS
VTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCPSVLNFGMGLVIA
LYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLMIAIAIFFTFTLQ
FYVPVTILWKGLEHKIRPEKQNISEYGLRVFLVLLCGGIAVALPNLGPFI
SLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRLWKNSGLILFGVVG
FVAGTYVSIIEFHAEFSSGH*

RH52922.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23811-PA 644 GF23811-PA 154..644 32..520 2421 92.5 Plus
Dana\GF11466-PA 502 GF11466-PA 67..493 83..511 981 45.7 Plus
Dana\GF15226-PA 452 GF15226-PA 39..445 52..453 905 45.5 Plus
Dana\GF10626-PA 462 GF10626-PA 26..462 84..518 876 43.6 Plus
Dana\GF24851-PA 453 GF24851-PA 1..453 62..517 871 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13950-PA 616 GG13950-PA 128..616 32..520 2469 95.3 Plus
Dere\GG10546-PA 506 GG10546-PA 39..499 52..511 1024 44.5 Plus
Dere\GG22563-PA 477 GG22563-PA 43..474 83..517 981 46 Plus
Dere\GG14028-PA 519 GG14028-PA 63..515 65..520 889 42.5 Plus
Dere\GG14841-PA 451 GG14841-PA 13..451 77..517 876 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16577-PA 591 GH16577-PA 80..586 18..520 2237 83.1 Plus
Dgri\GH10379-PA 509 GH10379-PA 81..506 84..511 965 44.8 Plus
Dgri\GH22642-PA 479 GH22642-PA 46..456 83..498 936 44.5 Plus
Dgri\GH15148-PA 470 GH15148-PA 24..464 76..517 905 42.8 Plus
Dgri\GH14926-PA 472 GH14926-PA 4..472 55..518 904 42.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PD 490 CG43693-PD 1..490 31..520 2562 100 Plus
CG43693-PE 499 CG43693-PE 6..499 24..520 2535 98.4 Plus
CG43693-PG 572 CG43693-PG 84..572 32..520 2534 99.2 Plus
CG43693-PB 502 CG43693-PB 7..502 25..520 2533 98 Plus
CG43693-PA 502 CG43693-PA 7..502 25..520 2533 98 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13867-PA 592 GI13867-PA 81..587 18..520 2234 83.5 Plus
Dmoj\GI21155-PA 482 GI21155-PA 3..475 35..511 993 42.8 Plus
Dmoj\GI17357-PA 519 GI17357-PA 37..512 46..511 973 42.6 Plus
Dmoj\GI12085-PA 470 GI12085-PA 30..464 83..517 895 43.2 Plus
Dmoj\GI11443-PA 466 GI11443-PA 4..466 55..518 890 42.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15745-PA 618 GL15745-PA 122..618 29..520 2396 90.1 Plus
Dper\GL25941-PA 508 GL25941-PA 75..501 87..511 1017 47.4 Plus
Dper\GL11031-PA 477 GL11031-PA 51..474 91..517 960 45 Plus
Dper\GL15673-PA 479 GL15673-PA 3..479 55..518 887 43.2 Plus
Dper\GL17962-PA 435 GL17962-PA 15..422 47..509 798 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19514-PA 507 GA19514-PA 6..507 25..520 2381 89.6 Plus
Dpse\GA25197-PA 508 GA25197-PA 75..501 87..511 1017 47.4 Plus
Dpse\GA21321-PA 477 GA21321-PA 51..474 91..517 960 45 Plus
Dpse\GA17443-PA 469 GA17443-PA 15..456 47..509 908 42.4 Plus
Dpse\GA20662-PA 479 GA20662-PA 13..479 64..518 889 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24786-PA 440 GM24786-PA 7..431 25..449 2126 94.6 Plus
Dsec\GM16926-PA 508 GM16926-PA 39..501 52..511 1024 44.6 Plus
Dsec\GM20346-PA 474 GM20346-PA 49..471 93..517 974 45.9 Plus
Dsec\GM24863-PA 519 GM24863-PA 60..515 62..520 879 42.2 Plus
Dsec\GM14464-PA 451 GM14464-PA 22..451 86..517 875 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12836-PA 502 GD12836-PA 7..502 25..520 2497 95.2 Plus
Dsim\GD23535-PA 508 GD23535-PA 39..501 52..511 1023 44.4 Plus
Dsim\GD25825-PA 474 GD25825-PA 49..471 93..517 974 46.1 Plus
Dsim\GD13662-PA 451 GD13662-PA 22..451 86..517 882 41.6 Plus
Dsim\GD14275-PA 462 GD14275-PA 26..462 84..518 873 43.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11728-PA 601 GJ11728-PA 90..596 18..520 2228 82.3 Plus
Dvir\GJ18031-PA 518 GJ18031-PA 86..511 84..511 976 45.7 Plus
Dvir\GJ21005-PA 490 GJ21005-PA 56..466 83..498 935 45.4 Plus
Dvir\GJ13356-PA 471 GJ13356-PA 31..466 83..518 910 42.8 Plus
Dvir\GJ13640-PA 466 GJ13640-PA 13..466 64..518 893 43.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12679-PA 588 GK12679-PA 83..588 20..520 2283 86.2 Plus
Dwil\GK18413-PA 501 GK18413-PA 18..494 48..511 1013 44.6 Plus
Dwil\GK18659-PA 501 GK18659-PA 19..494 49..511 1012 44.7 Plus
Dwil\GK21740-PA 479 GK21740-PA 53..476 91..518 971 45.1 Plus
Dwil\GK11241-PA 488 GK11241-PA 52..488 84..518 905 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20249-PA 599 GE20249-PA 111..599 32..520 2539 97.8 Plus
Dyak\GE18766-PA 509 GE18766-PA 39..502 52..511 1023 44.3 Plus
Dyak\GE13433-PA 477 GE13433-PA 52..474 93..517 985 46.6 Plus
Dyak\GE21231-PA 519 GE21231-PA 78..513 83..518 875 42.8 Plus
Dyak\GE21779-PA 465 GE21779-PA 29..465 84..518 863 42.9 Plus