Clone RH53953 Report

Search the DGRC for RH53953

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:539
Well:53
Vector:pFlc-1
Associated Gene/Transcriptmfas-RE
Protein status:RH53953.pep: gold
Sequenced Size:2778

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mfas-RE 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RH53953.complete Sequence

2778 bp assembled on 2011-01-07

GenBank Submission: BT125878.1

> RH53953.complete
GAGTTAGTTTTAAACTGCGACTTGAAGCGGCAACATCGTCGGATCAAGCA
ACACATAACAACTTTCCTCCCAACCGAGGCTCCAGATTAAAATTGTGATA
CCAAACATGCTACGGCTGTGGGCCTGCCTGCTCCTCCTGGGATCAATCCA
GATCCAGGCGGTTCCATTCTACGGCGATTCAAGTTCTGAAGAGGTTGCCG
AATTCGATGACTCCTCGGATTCCACACACGAGTCCTCAGATAACTCCAGC
GGATACGACACCGAGTTCGTGCCACTGGAGCACCAGCAGCAGCCGCAGGG
ACGCCAGGAGACGGCGGCCACCGTTCCCGCTCAAACCCCCAGCGGTGTGG
AGCAGAAGCCGTTCAATGTGGACACCATCACCACGGATGTGAATTCCCCA
AATCCGGCCATCTTCTTCCAGCAATCGTTCCCCTTCTTTGGCAATGAGTT
CTTCAATTCGTTCGGAGGCTTTGGCTTTGGAGCTGCCCAGGAGCCCTGGT
GGAAGGGACCCAATGTGTGCACCGAAAAGGAGGAAGACGAGACTGTGGCC
AGTGAAACGGAGGCAGAAGAAACCGTGGACACCTTTGGCCAGGAACGTGA
TGGCGTTACCAACGTGGTGCGATCCCCACTCTTTGGCCAGTTCCAGTTCA
GCGTTAACTCCTGCGCCGAGAAGCCCAACAAGCACGTCTGCACCAAGATC
GTGAATCAAAATGGCAAGAAGAAAACGCTGACGCTGACCCGCCAGTGCTG
CTATGGATATGGACGCCCCAGAAACGCTGACTTCACAACGCCCTGCGAGA
AGATCGACATCAAGGACGTGGAGGCCACGGCCAGTGACATGGGTGCCAAG
CAGTTCCTGGAGAGTGCACGCACCGCCGGTGAGCTGGCCGATATGCTCGG
AGCAGGCAGTGGCAAGAAGGTGACCCTCTTCGTGCCCAACGACGCCGCCT
TCATGGAGTACCGTGGTCATCATCAGCAGGAGAATAATGTGGAAGATGCC
AAGGCCGAGGCTTCCAAGCCATCCATCTACAAACTGCACGCTGTTCTCGG
CGAAGTTCAGCTGGAGGATGTGCCCAATGAGAAGCTTCTGCAGACGGAGC
TGCCTGACCAGAAGATCCGCATCAACAGCTACCAGCTGCCTGCGGCTTTG
GGCCTGGAACCCTACCGCTTTGCCGCCAACTGTGTGCCCATCGAGAAGCA
CGACAAGCTCTCGGAGCAGGCCCTTGTCCACACTCTGGGCGGAGTCCTGA
AGCCGCTGACCAAGAACCTTATGGATATCATCAGGGAGCGTGCGGATATG
TCCATTATGCGCACCGTTCTGGAGAAGACCAACCTGAGCGCCATGCTAGA
GGATGACAAGCCAGTGACCATCTTTGTGCCCACCGATGCCGCCTTCGACA
AGTTGGAACCTCATCTGCGTCGAGCCCTCAAGGAAGGTCGCGGTTGTGCC
TCCAACATCCTGAAGAACCATTTGCTGGACCTCACCTTCTGCTCGCTGGC
CACTGTTCCGGGTGCCAAGACGACGGCCTACAATCTACTGGGAGAACCCC
TGCTCCTCAACCGAACCCACCGCGCTGCGAATCAGACTGGACCGACTCCC
ATCTACATCAATAACTTGGCCAAAATCATTGATGCCGATATCATGGGCAC
CAATGGTGTGCTGCACGTAATCGACACCATCCTGCCCACCGAATCGGCTC
TGCCCATGACCTCGCTGATGTCGCAAAAGAACCTGACCATCTTCCAGCGA
TTGCTGGAGGCCTCCGGCTACGATGATCAGTTCGACGATCTGGACAACGT
GACCATCTTTGCACCAACTGACAAGGCTCTGCAGAATACGGAATGGGCTC
GCATGCTCAAGGAACAGCCGGAGCTGCTGAATCATAACTTGGATCTGCTG
GAGTTCCTTAACTACCATGTGGTCAAGCCCATGATCAAGACCTGTGACCT
GTCGGAGAAGTCCCTGCCCACGGTTGCTGGATCTAGTGTGCGTCTGAACC
TGTACTCCACCCATGCTCTCTTCTCGGACGTGATGAACCGGGCAACGGTA
AACTGTGCCCGTTTGGTGCACTTCGATGACGAGAGCTGCGGATCCGTTCT
CCACCAGGTGGATCGTGCCTTGGCGCCTCCCAAGAATAACATGCTTAAGC
TGCTGGAGGCTAATCCCAACTACAGCAAGTTCCTGGAGCTGGTTCGTAAG
GCTAATCTTACACAGCTGCTGTCCAACGATTCGAGGAGTCTCACCCTGCT
GGTGCCAAAGAACGATATCTTCGAGGAGCTGAACGAGTCCGGTGAGGGTT
CAAAGCCCGCCGATCCCATGGCCTTGGTCAAAACCCATATCGTTGAGGAT
GTTGTCTGCTGTGCCGGCATTATCCCAACCAACTGGCCATTTGTCCGCTC
CATCGAGTCCATCTCTGGCCAGCATCTGCGTATCACCCGCGATCGTCGTC
CCAAGATCGAGAACGCCGGCGTCACCAAGTGCGATGTGGTGGCCACCAAT
GGAATTCTCCATGAGATCAACGACATCATCGTGCCACGCCCACAGCGCCA
GCAACAGCAGCGACCCCAGCTGATCCCGCCCGGAGCTGGCTATCAGCCAC
AGGGCGATTTCGATGTCTTCTTCTGAGCGGTGCTCGTCCCCATCTCATGC
ATATTGATATATAAAGCAGATATTTATATTTACTCTTAACGATTTGTCAA
CTGATTGGAAGCCGCAAAAAGCTCAGAATCTCCTCTGATAAATAAAATAA
ATAGTATTAAAACAAAAAAAAAAAAAAA

RH53953.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7810964..7811646 2137..1455 3385 99.7 Minus
chr3R 27901430 chr3R 7810277..7810902 2763..2138 3085 99.5 Minus
chr3R 27901430 chr3R 7811715..7812183 1454..986 2285 99.1 Minus
chr3R 27901430 chr3R 7812246..7812531 985..700 1430 100 Minus
chr3R 27901430 chr3R 7812596..7812788 699..507 950 99.5 Minus
chr3R 27901430 chr3R 7814075..7814216 507..366 710 100 Minus
chr3R 27901430 chr3R 7814627..7814745 365..247 595 100 Minus
chr3R 27901430 chr3R 7818157..7818267 177..67 540 99.1 Minus
chr3R 27901430 chr3R 7817486..7817557 249..178 360 100 Minus
chr3R 27901430 chr3R 7818666..7818730 66..2 310 98.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-RO 2520 CG3359-PO 1..2520 107..2626 12600 100 Plus
mfas-RE 2520 CG3359-PE 1..2520 107..2626 12600 100 Plus
mfas-RM 2523 CG3359-PM 1..2523 107..2626 12535 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-RO 2764 CG3359-RO 3..2764 2..2763 13795 100 Plus
mfas-RG 2767 CG3359-RG 3..2767 2..2763 13730 99.9 Plus
mfas-RE 2786 CG3359-RE 3..2786 2..2763 13540 99.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-PO 839 CG3359-PO 1..839 107..2623 3817 100 Plus
mfas-PE 839 CG3359-PE 1..839 107..2623 3817 100 Plus
mfas-PM 840 CG3359-PM 1..840 107..2623 3805 99.9 Plus
mfas-PG 840 CG3359-PG 1..840 107..2623 3805 99.9 Plus
mfas-PF 840 CG3359-PF 1..840 107..2623 3805 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11985549..11986231 2137..1455 3415 100 Minus
3R 32079331 3R 11984859..11985487 2766..2138 3145 100 Minus
3R 32079331 3R 11986304..11986772 1454..986 2345 100 Minus
3R 32079331 3R 11986835..11987120 985..700 1430 100 Minus
3R 32079331 3R 11987185..11987377 699..507 965 100 Minus
3R 32079331 3R 11988658..11988799 507..366 710 100 Minus
3R 32079331 3R 11989210..11989328 365..247 595 100 Minus
3R 32079331 3R 11992742..11992852 177..67 555 100 Minus
3R 32079331 3R 11992072..11992143 249..178 360 100 Minus
3R 32079331 3R 11993249..11993313 66..2 310 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11726380..11727062 2137..1455 3415 100 Minus
3R 31820162 3R 11725690..11726318 2766..2138 3145 100 Minus
3R 31820162 3R 11727135..11727603 1454..986 2345 100 Minus
3R 31820162 3R 11727666..11727951 985..700 1430 100 Minus
3R 31820162 3R 11728016..11728208 699..507 965 100 Minus
3R 31820162 3R 11729489..11729630 507..366 710 100 Minus
3R 31820162 3R 11730041..11730159 365..247 595 100 Minus
3R 31820162 3R 11733573..11733683 177..67 555 100 Minus
3R 31820162 3R 11732903..11732974 249..178 360 100 Minus
3R 31820162 3R 11734080..11734144 66..2 310 98.4 Minus
Blast to na_te.dros performed on 2014-11-27 16:47:41 has no hits.

RH53953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:58:18 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7818666..7818730 1..66 96   Minus
chr3R 7818157..7818267 67..177 99 <- Minus
chr3R 7817486..7817557 178..249 100 <- Minus
chr3R 7814627..7814742 250..365 100 <- Minus
chr3R 7814075..7814216 366..507 100 <- Minus
chr3R 7812596..7812787 508..699 99 <- Minus
chr3R 7812246..7812531 700..985 100 <- Minus
chr3R 7811715..7812183 986..1454 99 <- Minus
chr3R 7810964..7811646 1455..2137 99 <- Minus
chr3R 7810277..7810902 2138..2763 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-07 15:05:59 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RO 1..2520 107..2626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:39:08 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RE 1..2520 107..2626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:58:18 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RE 1..2520 107..2626 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:05:59 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RO 1..2764 1..2763 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:39:08 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RO 1..2764 1..2763 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:58:18 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
mfas-RO 1..2764 1..2763 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:58:18 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11993249..11993313 1..66 96   Minus
3R 11992742..11992852 67..177 100 <- Minus
3R 11992072..11992143 178..249 100 <- Minus
3R 11989210..11989325 250..365 100 <- Minus
3R 11988658..11988799 366..507 100 <- Minus
3R 11987185..11987376 508..699 100 <- Minus
3R 11986835..11987120 700..985 100 <- Minus
3R 11986304..11986772 986..1454 100 <- Minus
3R 11985549..11986231 1455..2137 100 <- Minus
3R 11984862..11985487 2138..2763 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:39:08 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7818971..7819035 1..66 96   Minus
arm_3R 7818464..7818574 67..177 100 <- Minus
arm_3R 7817794..7817865 178..249 100 <- Minus
arm_3R 7814932..7815047 250..365 100 <- Minus
arm_3R 7814380..7814521 366..507 100 <- Minus
arm_3R 7812907..7813098 508..699 100 <- Minus
arm_3R 7812557..7812842 700..985 100 <- Minus
arm_3R 7812026..7812494 986..1454 100 <- Minus
arm_3R 7811271..7811953 1455..2137 100 <- Minus
arm_3R 7810584..7811209 2138..2763 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:24 Download gff for RH53953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11734080..11734144 1..66 96   Minus
3R 11733573..11733683 67..177 100 <- Minus
3R 11732903..11732974 178..249 100 <- Minus
3R 11730041..11730156 250..365 100 <- Minus
3R 11729489..11729630 366..507 100 <- Minus
3R 11728016..11728207 508..699 100 <- Minus
3R 11727666..11727951 700..985 100 <- Minus
3R 11727135..11727603 986..1454 100 <- Minus
3R 11726380..11727062 1455..2137 100 <- Minus
3R 11725693..11726318 2138..2763 100 <- Minus

RH53953.pep Sequence

Translation from 106 to 2625

> RH53953.pep
MLRLWACLLLLGSIQIQAVPFYGDSSSEEVAEFDDSSDSTHESSDNSSGY
DTEFVPLEHQQQPQGRQETAATVPAQTPSGVEQKPFNVDTITTDVNSPNP
AIFFQQSFPFFGNEFFNSFGGFGFGAAQEPWWKGPNVCTEKEEDETVASE
TEAEETVDTFGQERDGVTNVVRSPLFGQFQFSVNSCAEKPNKHVCTKIVN
QNGKKKTLTLTRQCCYGYGRPRNADFTTPCEKIDIKDVEATASDMGAKQF
LESARTAGELADMLGAGSGKKVTLFVPNDAAFMEYRGHHQQENNVEDAKA
EASKPSIYKLHAVLGEVQLEDVPNEKLLQTELPDQKIRINSYQLPAALGL
EPYRFAANCVPIEKHDKLSEQALVHTLGGVLKPLTKNLMDIIRERADMSI
MRTVLEKTNLSAMLEDDKPVTIFVPTDAAFDKLEPHLRRALKEGRGCASN
ILKNHLLDLTFCSLATVPGAKTTAYNLLGEPLLLNRTHRAANQTGPTPIY
INNLAKIIDADIMGTNGVLHVIDTILPTESALPMTSLMSQKNLTIFQRLL
EASGYDDQFDDLDNVTIFAPTDKALQNTEWARMLKEQPELLNHNLDLLEF
LNYHVVKPMIKTCDLSEKSLPTVAGSSVRLNLYSTHALFSDVMNRATVNC
ARLVHFDDESCGSVLHQVDRALAPPKNNMLKLLEANPNYSKFLELVRKAN
LTQLLSNDSRSLTLLVPKNDIFEELNESGEGSKPADPMALVKTHIVEDVV
CCAGIIPTNWPFVRSIESISGQHLRITRDRRPKIENAGVTKCDVVATNGI
LHEINDIIVPRPQRQQQQRPQLIPPGAGYQPQGDFDVFF*

RH53953.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17754-PA 914 GF17754-PA 120..914 47..839 3848 91.6 Plus
Dana\GF15601-PA 1175 GF15601-PA 890..1175 534..809 176 26 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17171-PA 843 GG17171-PA 12..843 12..839 4060 96.2 Plus
Dere\GG10157-PA 1166 GG10157-PA 881..1166 534..809 177 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12578-PA 894 GH12578-PA 104..894 51..839 3460 81.1 Plus
Dgri\GH10598-PA 1206 GH10598-PA 921..1206 534..809 173 25.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-PO 839 CG3359-PO 1..839 1..839 4374 100 Plus
mfas-PE 839 CG3359-PE 1..839 1..839 4374 100 Plus
mfas-PM 840 CG3359-PM 1..840 1..839 4362 99.9 Plus
mfas-PG 840 CG3359-PG 1..840 1..839 4362 99.9 Plus
mfas-PF 840 CG3359-PF 1..840 1..839 4362 99.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24063-PA 883 GI24063-PA 94..883 43..839 3311 79.3 Plus
Dmoj\GI17386-PA 1223 GI17386-PA 938..1223 534..809 166 24 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21586-PA 236 GL21586-PA 117..233 46..161 351 78.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17404-PD 845 GA17404-PD 1..845 1..839 3661 84.4 Plus
Dpse\GA17404-PB 821 GA17404-PB 1..821 1..839 3654 83.6 Plus
Dpse\GA17404-PA 916 GA17404-PA 117..916 46..839 3561 85.6 Plus
Dpse\GA17404-PC 892 GA17404-PC 93..892 46..839 3560 85.6 Plus
Dpse\GA17219-PA 1194 GA17219-PA 897..1194 517..809 176 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26050-PA 905 GM26050-PA 113..905 47..839 4098 99.5 Plus
Dsec\GM15050-PA 151 GM15050-PA 56..151 39..134 484 93.8 Plus
Dsec\GM14896-PA 1162 GM14896-PA 877..1162 534..809 177 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20613-PA 906 GD20613-PA 114..906 47..839 4091 99.4 Plus
Dsim\GD11970-PA 564 GD11970-PA 293..563 548..808 169 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23688-PA 888 GJ23688-PA 1..888 1..839 3506 76.5 Plus
Dvir\GJ18063-PA 1178 GJ18063-PA 893..1178 534..809 174 25.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11667-PA 933 GK11667-PA 116..933 41..839 3427 80.3 Plus
Dwil\GK15101-PA 1174 GK15101-PA 889..1174 534..809 168 25.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24561-PA 908 GE24561-PA 113..908 47..839 3985 97 Plus
Dyak\GE25093-PA 1167 GE25093-PA 882..1167 534..809 175 25.3 Plus

RH53953.hyp Sequence

Translation from 106 to 2625

> RH53953.hyp
MLRLWACLLLLGSIQIQAVPFYGDSSSEEVAEFDDSSDSTHESSDNSSGY
DTEFVPLEHQQQPQGRQETAATVPAQTPSGVEQKPFNVDTITTDVNSPNP
AIFFQQSFPFFGNEFFNSFGGFGFGAAQEPWWKGPNVCTEKEEDETVASE
TEAEETVDTFGQERDGVTNVVRSPLFGQFQFSVNSCAEKPNKHVCTKIVN
QNGKKKTLTLTRQCCYGYGRPRNADFTTPCEKIDIKDVEATASDMGAKQF
LESARTAGELADMLGAGSGKKVTLFVPNDAAFMEYRGHHQQENNVEDAKA
EASKPSIYKLHAVLGEVQLEDVPNEKLLQTELPDQKIRINSYQLPAALGL
EPYRFAANCVPIEKHDKLSEQALVHTLGGVLKPLTKNLMDIIRERADMSI
MRTVLEKTNLSAMLEDDKPVTIFVPTDAAFDKLEPHLRRALKEGRGCASN
ILKNHLLDLTFCSLATVPGAKTTAYNLLGEPLLLNRTHRAANQTGPTPIY
INNLAKIIDADIMGTNGVLHVIDTILPTESALPMTSLMSQKNLTIFQRLL
EASGYDDQFDDLDNVTIFAPTDKALQNTEWARMLKEQPELLNHNLDLLEF
LNYHVVKPMIKTCDLSEKSLPTVAGSSVRLNLYSTHALFSDVMNRATVNC
ARLVHFDDESCGSVLHQVDRALAPPKNNMLKLLEANPNYSKFLELVRKAN
LTQLLSNDSRSLTLLVPKNDIFEELNESGEGSKPADPMALVKTHIVEDVV
CCAGIIPTNWPFVRSIESISGQHLRITRDRRPKIENAGVTKCDVVATNGI
LHEINDIIVPRPQRQQQQRPQLIPPGAGYQPQGDFDVFF*

RH53953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
mfas-PO 839 CG3359-PO 1..839 1..839 4374 100 Plus
mfas-PE 839 CG3359-PE 1..839 1..839 4374 100 Plus
mfas-PM 840 CG3359-PM 1..840 1..839 4362 99.9 Plus
mfas-PG 840 CG3359-PG 1..840 1..839 4362 99.9 Plus
mfas-PF 840 CG3359-PF 1..840 1..839 4362 99.9 Plus