Clone RH61136 Report

Search the DGRC for RH61136

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:611
Well:36
Vector:pFlc-1
Associated Gene/TranscriptCG5172-RD
Protein status:RH61136.pep: gold
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5172-RD 2009-10-15 EST screening

Clone Sequence Records

RH61136.complete Sequence

827 bp assembled on 2009-10-23

GenBank Submission: BT100165.1

> RH61136.complete
GATCAGTAATATTGAGCCTCCAGCAGTGATTACACAGCGGTTCTAAGTCG
GTCTAACAATCTTTTTTTTTACTATATTTTTTTGAGTGACTAAAGAGTTC
TAAGGATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCCTGCTGATC
GCCTTAACCTCAGCCGGTTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTA
CGGCGGTGGTGGTGGTGGTGGCTACGGCGGTGGTGGTGGTGGTCAGAGCG
GCTACGGCGGCGGTGGCCAAAAGAACGGAGGAGGCGGCCATGGAGGTGGC
GGCCAGGGAAGCTACGGAGGCGGTAGCCAAGGTGGACATGGAGGCGGTGG
CCAAGGAGGTTGGCAGAAGAACGGAGGAGGTGGTGGACAAGGAGGCTATG
GAGGTGGCAATCAAGGTGGCCACGGAGGACAAGGAGGTTATGGCGGCGGC
GGTCATGGAGGCGGTGGCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGG
TAGTTCCGTGTCCTGGCAGGGCGGAAATGGAGGCAACAAGAACGGAGGCG
GCGGAGGAGGTGGTGGTGGCCTGTACGGTGGTGGTGGCGGTGGAGGTGGC
AAACAACATGGCGGTGGCTGGTAATCAAACCACCAGGAGCAGCTAATCCA
CCGTCTGATGCTGACTTGTGTTCCATGGCATAGAGATAGAGACAATCCCT
AGATTCTTCTATTTTTCTTCTATCGAAAGCCCAATTTTTCCTGCTTTTAA
TGTTTTTTATACTAATAAATCTTGTTTATGCATTTTGTAAAAAAAAAAAA
AAAAAAAAAAGAAAAAAAAAAGAAAAA

RH61136.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-RD 782 CG5172-RD 2..782 2..782 3905 100 Plus
CG5172-RC 529 CG5172-RC 2..382 2..382 1905 100 Plus
CG5172-RC 529 CG5172-RC 378..529 635..786 745 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17111728..17112104 414..790 1855 99.5 Plus
chrX 22417052 chrX 17110894..17111224 2..332 1655 100 Plus
chrX 22417052 chrX 17111575..17111662 330..417 440 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-RD 519 CG5172-PD 1..519 106..624 2595 100 Plus
CG5172-RC 321 CG5172-PC 1..277 106..382 1385 100 Plus
CG5172-RC 321 CG5172-PC 273..321 635..683 230 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-RD 788 CG5172-RD 2..788 2..788 3935 100 Plus
CG5172-RC 531 CG5172-RC 2..382 2..382 1905 100 Plus
CG5172-RC 531 CG5172-RC 378..531 635..788 755 99.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 03:17:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17222277..17222653 414..790 1885 100 Plus
X 23542271 X 17221443..17221773 2..332 1655 100 Plus
X 23542271 X 17222124..17222211 330..417 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17230375..17230751 414..790 1885 100 Plus
X 23527363 X 17229541..17229871 2..332 1655 100 Plus
X 23527363 X 17230222..17230309 330..417 440 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:17:45 has no hits.

RH61136.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:32:16 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17111915..17112102 601..788 98   Plus
chrX 17111730..17111833 416..519 100 == Plus
chrX 17111577..17111660 332..415 100 -> Plus
chrX 17111136..17111223 244..331 100 -> Plus
chrX 17110893..17111066 1..174 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-23 14:59:52 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:46 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:42 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:32:16 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 1..519 106..624 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-23 14:59:51 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 2..667 2..667 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:46 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 2..667 2..667 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:42 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 2..788 2..788 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:32:16 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 2..788 2..788 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:32:16 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
X 17222279..17222651 416..788 100   Plus
X 17222126..17222209 332..415 100 -> Plus
X 17221442..17221772 1..331 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:42 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17116312..17116684 416..788 100   Plus
arm_X 17116159..17116242 332..415 100 -> Plus
arm_X 17115475..17115805 1..331 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:41 Download gff for RH61136.complete
Subject Subject Range Query Range Percent Splice Strand
X 17230377..17230749 416..788 100   Plus
X 17230224..17230307 332..415 100 -> Plus
X 17229540..17229870 1..331 99 -> Plus

RH61136.pep Sequence

Translation from 105 to 623

> RH61136.pep
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGGGGYGGGGGGQSGY
GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGGQGGYGG
GNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKNGGGG
GGGGGLYGGGGGGGGKQHGGGW*

RH61136.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-PD 172 CG5172-PD 1..172 1..172 998 100 Plus
CG5172-PC 106 CG5172-PC 1..92 1..92 526 100 Plus
CG14191-PA 193 CG14191-PA 3..188 8..172 395 46.9 Plus
Cpr47Ef-PD 601 CG13214-PD 248..406 25..172 386 51.6 Plus
Cpr47Ef-PC 612 CG13214-PC 248..406 25..172 386 51.6 Plus
Cpr47Ef-PD 601 CG13214-PD 306..473 21..171 382 54.2 Plus
Cpr47Ef-PD 601 CG13214-PD 272..451 19..172 380 48.9 Plus
Cpr47Ef-PD 601 CG13214-PD 248..420 24..171 378 51.4 Plus
Cpr47Ef-PD 601 CG13214-PD 340..505 21..171 373 50.9 Plus
Cpr47Ef-PD 601 CG13214-PD 233..390 22..171 372 51.8 Plus
Cpr47Ef-PD 601 CG13214-PD 374..527 21..171 358 50 Plus
Cpr47Ef-PD 601 CG13214-PD 405..591 21..169 303 43.9 Plus
Cpr47Ef-PD 601 CG13214-PD 235..341 37..172 268 48.9 Plus
CG14191-PA 193 CG14191-PA 79..190 13..103 221 46 Plus
Cpr47Ef-PD 601 CG13214-PD 29..119 20..125 211 48.2 Plus
Cpr47Ef-PD 601 CG13214-PD 31..277 16..171 211 31.6 Plus
CG5172-PC 106 CG5172-PC 24..81 107..171 146 56.7 Plus

RH61136.hyp Sequence

Translation from 105 to 623

> RH61136.hyp
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGGGGYGGGGGGQSGY
GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGGQGGYGG
GNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKNGGGG
GGGGGLYGGGGGGGGKQHGGGW*

RH61136.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-PD 172 CG5172-PD 1..172 1..172 998 100 Plus
CG5172-PC 106 CG5172-PC 1..92 1..92 526 100 Plus
CG14191-PA 193 CG14191-PA 3..188 8..172 395 46.9 Plus
Cpr47Ef-PD 601 CG13214-PD 248..406 25..172 386 51.6 Plus
Cpr47Ef-PC 612 CG13214-PC 248..406 25..172 386 51.6 Plus
Cpr47Ef-PD 601 CG13214-PD 306..473 21..171 382 54.2 Plus
Cpr47Ef-PD 601 CG13214-PD 272..451 19..172 380 48.9 Plus
Cpr47Ef-PD 601 CG13214-PD 248..420 24..171 378 51.4 Plus
Cpr47Ef-PD 601 CG13214-PD 340..505 21..171 373 50.9 Plus
Cpr47Ef-PD 601 CG13214-PD 233..390 22..171 372 51.8 Plus
Cpr47Ef-PD 601 CG13214-PD 374..527 21..171 358 50 Plus
Cpr47Ef-PD 601 CG13214-PD 405..591 21..169 303 43.9 Plus
Cpr47Ef-PD 601 CG13214-PD 235..341 37..172 268 48.9 Plus
CG14191-PA 193 CG14191-PA 79..190 13..103 221 46 Plus
Cpr47Ef-PD 601 CG13214-PD 29..119 20..125 211 48.2 Plus
Cpr47Ef-PD 601 CG13214-PD 31..277 16..171 211 31.6 Plus
CG5172-PC 106 CG5172-PC 24..81 107..171 146 56.7 Plus