Clone RH67364 Report

Search the DGRC for RH67364

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:673
Well:64
Vector:pFlc-1
Associated Gene/TranscriptIndy-RB
Protein status:RH67364.pep: gold
Sequenced Size:2577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Indy-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH67364.complete Sequence

2577 bp assembled on 2009-11-03

GenBank Submission: BT100230.1

> RH67364.complete
GATTCGCATATTAGTCGTCGAACGCAAAGCAACATATTCATAAAAAGTGG
TCTAGCCAACGAATATATATATATATATATGTTATTTTTCGGCGCGGTGG
TGGAAATTATGAAATAATCGCTTACGGTTGTGCTGAAAGAGAAACGGCGT
GATCAATTCTTCAGATATACCAATAGTATCTATACCATATAGATCCCCAA
CCATGGCGACCGAAACTACAAAAATGATCTACACGCCACCGCCACTGGAC
ATCAAAATGGAAATTGAAATTGGCGAACAACCCCAGCCTCCGGTGAAGTG
CTCCAACTTCTTCGCTAACCACTGGAAGGGATTGGTTGTGTTCCTGGTGC
CGCTGCTATGTCTGCCTGTTATGCTGCTAAACGAAGGCGCCGAATTTCGG
TGCATGTACCTCCTTTTGGTAATGGCCATATTTTGGGTTACGGAAGCCTT
GCCTCTCTATGTGACGTCCATGATACCGATTGTGGCCTTCCCAATAATGG
GTATAATGAGCTCGGATCAGACTTGCCGCTTGTACTTCAAGGATACGCTG
GTGATGTTCATGGGCGGCATTATGGTCGCCCTGGCTGTGGAGTACTGTAA
TCTACACAAACGTCTTGCCTTGAGGGTAATCCAGATCGTGGGCTGCAGTC
CCCGCAGATTACACTTTGGCCTCATCATGGTTACAATGTTTTTGAGCATG
TGGATTTCGAACGCCGCCTGTACTGCCATGATGTGTCCGATTATCCAAGC
CGTGCTGGAGGAGCTGCAGGCTCAGGGTGTCTGCAAAATCAACCATGAGC
CTCAATACCAAATCGTTGGAGGCAACAAGAAAAACAACGAGGATGAGCCA
CCATACCCCACCAAGATCACTCTGTGCTACTATCTGGGCATTGCCTACGC
CTCCTCGCTGGGTGGCTGTGGAACCATCATCGGAACTGCCACCAATCTTA
CCTTCAAGGGCATCTACGAGGCTCGTTTCAAGAACTCCACCGAACAGATG
GACTTCCCCACCTTCATGTTCTACTCGGTGCCATCCATGTTGGTCTACAC
CTTGCTGACATTCGTGTTCCTGCAATGGCACTTCATGGGTCTGTGGCGTC
CCAAGAGCAAGGAGGCACAGGAAGTCCAGAGGGGACGAGAGGGCGCCGAT
GTCGCCAAAAAGGTTATCGATCAGCGCTACAAGGATCTGGGTCCCATGTC
CATTCACGAGATCCAAGTGATGATTCTGTTCATTTTTATGGTTGTGATGT
ACTTCACCCGCAAGCCCGGCATCTTTTTGGGATGGGCCGATTTGCTGAAT
TCCAAGGACATTCGTAACTCTATGCCCACTATTTTTGTCGTCGTCATGTG
CTTCATGCTGCCCGCCAATTATGCTTTCCTACGCTACTGCACCAGACGCG
GTGGTCCAGTGCCCACGGGTCCCACTCCATCGCTGATCACCTGGAAGTTC
ATCCAGACCAAGGTGCCATGGGGTCTGGTGTTCCTGCTTGGCGGTGGCTT
CGCTTTGGCCGAAGGCAGCAAGCAGAGCGGCATGGCCAAGCTGATTGGCA
ATGCTCTGATTGGATTGAAGGTTCTGCCCAACTCTGTCCTCTTACTGGTG
GTCATCCTGGTGGCTGTGTTCCTGACCGCCTTCAGCTCCAATGTGGCGAT
TGCCAACATTATTATTCCCGTTCTGGCCGAGATGTCCCTGGCCATTGAGA
TCCATCCTCTGTACCTGATCCTGCCCGCTGGCTTGGCCTGCAGTATGGCC
TTCCACCTGCCGGTTAGTACTCCGCCCAACGCTTTGGTTGCTGGCTATGC
CAACATTAGGACGAAGGACATGGCCATTGCTGGAATCGGTCCGACCATCA
TTACCATCATCACCCTGTTTGTTTTCTGCCAAACCTGGGGCCTGGTCGTC
TATCCGAACCTTAACTCGTTCCCCGAATGGGCTCAGATTTATGCCGCGGC
AGCACTGGGAAACAAGACGCACTAGATAGTTAGTAATTAGTGTAAATAAC
TAACATACCCGTCACAGCGATAAAGTTGAGGAAAATTTAGGGAATTTTAA
ACGAAAAGTGCCTTTGCTGACAGCGAAAAATGTGAAAAATATTTAACTAT
GTATACTTGCATTTCAGAGTTGCGAAAAGTTTTGATACAAAAGCATTACC
TACTGTTTAGAAAAATGTGTTAAAAAAAAAACGTATCGCAATATACTGTT
AATCAGGAATTGAACACCTGGTCTACGCACTCAGCTAAATATTTAAATAC
AAATTAATGTTACTTAATTGTTGCATTTAGCATAAAAATGGAAAAGATTT
GGAAAAGTTAGAACAGTTTGTTCAATGGCAGCCCTGGCCTGCTAATATTT
TAAATAACTAGACTGAGAGAACTTACATATTCATACATGTTTTTCAACTT
GTAAAAATTTTTAAATGAACAACTCACTCAATACTTCATTGCGAACCAAA
ATGAACACACAAATAGCGGTAGGCTAAGCTTAAATGATACTGTGTACATT
TTCAGATGATTTATGTTTTATATAGTTTGTAAAAAATATTAAATAATAAA
AAGCTCAAACGACGAAAAAAAAAAAAA

RH67364.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-RB 2676 Indy-RB 1..2562 2..2563 12810 100 Plus
Indy.a 2564 Indy.a 224..2561 226..2563 11690 100 Plus
Indy-RC 2599 Indy-RC 259..2596 226..2563 11690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18818290..18819169 2563..1684 4400 100 Minus
chr3L 24539361 chr3L 18819930..18820389 1306..847 2300 100 Minus
chr3L 24539361 chr3L 18819234..18819618 1684..1300 1910 99.7 Minus
chr3L 24539361 chr3L 18835678..18835902 226..2 1125 100 Minus
chr3L 24539361 chr3L 18820494..18820690 847..651 970 99.5 Minus
chr3L 24539361 chr3L 18820748..18820897 657..508 750 100 Minus
chr3L 24539361 chr3L 18821137..18821264 392..265 610 98.4 Minus
chr3L 24539361 chr3L 18820954..18821070 508..392 585 100 Minus
chr3L 24539361 chr3L 18821582..18821620 264..226 195 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-RB 1773 CG3979-PB 1..1773 203..1975 8865 100 Plus
Indy-RD 1719 CG3979-PD 1..1719 257..1975 8595 100 Plus
Indy-RA 1719 CG3979-PA 1..1719 257..1975 8595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-RB 2572 CG3979-RB 8..2569 2..2563 12810 100 Plus
Indy-RC 2600 CG3979-RC 260..2597 226..2563 11690 100 Plus
Indy-RD 2581 CG3979-RD 242..2578 227..2563 11685 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-PB 590 CG3979-PB 1..590 203..1972 2642 100 Plus
Indy-PD 572 CG3979-PD 1..572 257..1972 2547 100 Plus
Indy-PA 572 CG3979-PA 1..572 257..1972 2547 100 Plus
Indy-PC 572 CG3979-PC 1..572 257..1972 2547 100 Plus
CG33934-PE 556 CG33934-PE 49..555 395..1933 1317 52.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18828635..18829514 2563..1684 4400 100 Minus
3L 28110227 3L 18830275..18830734 1306..847 2300 100 Minus
3L 28110227 3L 18829579..18829963 1684..1300 1910 99.7 Minus
3L 28110227 3L 18846036..18846260 226..2 1125 100 Minus
3L 28110227 3L 18830839..18831035 847..651 970 99.5 Minus
3L 28110227 3L 18831093..18831242 657..508 750 100 Minus
3L 28110227 3L 18831494..18831621 392..265 640 100 Minus
3L 28110227 3L 18831311..18831427 508..392 585 100 Minus
3L 28110227 3L 18831947..18831985 264..226 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18821735..18822614 2563..1684 4400 100 Minus
3L 28103327 3L 18823375..18823834 1306..847 2300 100 Minus
3L 28103327 3L 18822679..18823063 1684..1300 1910 99.7 Minus
3L 28103327 3L 18839136..18839360 226..2 1125 100 Minus
3L 28103327 3L 18823939..18824135 847..651 970 99.4 Minus
3L 28103327 3L 18824193..18824342 657..508 750 100 Minus
3L 28103327 3L 18824594..18824721 392..265 640 100 Minus
3L 28103327 3L 18824411..18824527 508..392 585 100 Minus
3L 28103327 3L 18825047..18825085 264..226 195 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:57:31 has no hits.

RH67364.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:49:10 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18821582..18821619 227..264 100 <- Minus
chr3L 18821138..18821264 265..391 98 <- Minus
chr3L 18820954..18821070 392..508 100 <- Minus
chr3L 18820748..18820896 509..657 100 <- Minus
chr3L 18820495..18820683 658..846 100 <- Minus
chr3L 18819931..18820389 847..1305 100 <- Minus
chr3L 18819234..18819612 1306..1684 100 <- Minus
chr3L 18818325..18819168 1685..2528 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:19:18 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..1773 203..1975 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:16:41 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..1773 203..1975 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:21:48 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..1773 203..1975 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:10 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..1773 203..1975 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:19:17 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..2562 2..2564 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:16:41 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 1..2562 2..2564 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:21:48 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 6..2569 1..2564 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:10 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 6..2569 1..2564 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:10 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18846036..18846260 1..226 99   Minus
3L 18831947..18831984 227..264 100 <- Minus
3L 18831495..18831621 265..391 100 <- Minus
3L 18831311..18831427 392..508 100 <- Minus
3L 18831093..18831241 509..657 100 <- Minus
3L 18830840..18831028 658..846 100 <- Minus
3L 18830276..18830734 847..1305 100 <- Minus
3L 18829579..18829957 1306..1684 100 <- Minus
3L 18828634..18829513 1685..2564 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:21:48 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18839136..18839360 1..226 99   Minus
arm_3L 18825047..18825084 227..264 100 <- Minus
arm_3L 18824595..18824721 265..391 100 <- Minus
arm_3L 18824411..18824527 392..508 100 <- Minus
arm_3L 18824193..18824341 509..657 100 <- Minus
arm_3L 18823940..18824128 658..846 100 <- Minus
arm_3L 18823376..18823834 847..1305 100 <- Minus
arm_3L 18822679..18823057 1306..1684 100 <- Minus
arm_3L 18821734..18822613 1685..2564 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:06:20 Download gff for RH67364.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18839136..18839360 1..226 99   Minus
3L 18825047..18825084 227..264 100 <- Minus
3L 18824595..18824721 265..391 100 <- Minus
3L 18824411..18824527 392..508 100 <- Minus
3L 18824193..18824341 509..657 100 <- Minus
3L 18823940..18824128 658..846 100 <- Minus
3L 18823376..18823834 847..1305 100 <- Minus
3L 18822679..18823057 1306..1684 100 <- Minus
3L 18821734..18822613 1685..2564 99 <- Minus

RH67364.pep Sequence

Translation from 202 to 1974

> RH67364.pep
MATETTKMIYTPPPLDIKMEIEIGEQPQPPVKCSNFFANHWKGLVVFLVP
LLCLPVMLLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMG
IMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSP
RRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVLEELQAQGVCKINHEP
QYQIVGGNKKNNEDEPPYPTKITLCYYLGIAYASSLGGCGTIIGTATNLT
FKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRP
KSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMY
FTRKPGIFLGWADLLNSKDIRNSMPTIFVVVMCFMLPANYAFLRYCTRRG
GPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGN
ALIGLKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIEI
HPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTII
TIITLFVFCQTWGLVVYPNLNSFPEWAQIYAAAALGNKTH*

RH67364.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10804-PA 585 GF10804-PA 1..585 1..590 2770 90.7 Plus
Dana\GF17635-PA 556 GF17635-PA 16..555 32..577 1494 50.7 Plus
Dana\GF14052-PA 458 GF14052-PA 7..445 89..556 357 26.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15722-PA 590 GG15722-PA 1..589 1..589 2977 98 Plus
Dere\GG23714-PA 505 GG23714-PA 1..505 68..578 1454 52 Plus
Dere\GG23703-PA 562 GG23703-PA 14..553 32..577 1315 46.7 Plus
Dere\GG10343-PA 531 GG10343-PA 9..522 14..564 415 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17192-PA 653 GH17192-PA 1..586 1..590 2465 80.5 Plus
Dgri\GH17290-PA 556 GH17290-PA 1..555 15..578 1455 50.1 Plus
Dgri\GH11690-PA 469 GH11690-PA 11..449 93..553 465 29.1 Plus
Dgri\GH17301-PA 81 GH17301-PA 3..72 157..258 178 40.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-PB 590 CG3979-PB 1..590 1..590 3089 100 Plus
Indy-PD 572 CG3979-PD 1..572 19..590 2994 100 Plus
Indy-PA 572 CG3979-PA 1..572 19..590 2994 100 Plus
Indy-PC 572 CG3979-PC 1..572 19..590 2994 100 Plus
CG33934-PE 556 CG33934-PE 16..555 32..577 1531 51.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13959-PA 643 GI13959-PA 1..571 19..590 2439 82.2 Plus
Dmoj\GI22444-PA 472 GI22444-PA 1..465 74..544 1255 50.8 Plus
Dmoj\GI17135-PA 454 GI17135-PA 1..437 102..553 377 25.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25253-PA 558 GL25253-PA 1..558 1..590 2326 82.2 Plus
Dper\GL12087-PA 559 GL12087-PA 44..557 58..578 1463 52.6 Plus
Dper\GL12086-PA 580 GL12086-PA 5..567 25..589 1303 45.7 Plus
Dper\GL19025-PA 534 GL19025-PA 27..527 40..563 489 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23740-PA 587 GA23740-PA 1..587 1..590 2782 92.9 Plus
Dpse\GA17201-PA 559 GA17201-PA 44..557 58..578 1457 52.4 Plus
Dpse\Indy-2-PA 580 GA26188-PA 5..567 25..589 1304 45.6 Plus
Dpse\GA20251-PA 534 GA20251-PA 27..527 40..563 477 25.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14919-PA 590 GM14919-PA 1..590 1..590 3125 99.7 Plus
Dsec\GM17693-PA 518 GM17693-PA 11..517 65..577 1477 52.1 Plus
Dsec\GM17692-PA 562 GM17692-PA 40..553 58..577 1199 48.5 Plus
Dsec\GM11292-PA 528 GM11292-PA 9..521 14..566 454 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12325-PA 1005 GD12325-PA 419..1005 4..590 3137 99.1 Plus
Dsim\GD19336-PA 518 GD19336-PA 11..517 65..577 1455 52.1 Plus
Dsim\GD19335-PA 562 GD19335-PA 40..553 58..577 1160 48.7 Plus
Dsim\GD22211-PA 249 GD22211-PA 2..242 313..566 279 27.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13740-PA 643 GJ13740-PA 1..571 19..590 2416 81 Plus
Dvir\GJ11006-PA 554 GJ11006-PA 20..552 40..575 1469 52 Plus
Dvir\GJ16173-PA 529 GJ16173-PA 8..529 24..570 470 27.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20442-PA 572 GK20442-PA 1..572 19..590 2640 91.4 Plus
Dwil\GK22372-PA 514 GK22372-PA 1..498 74..577 1437 53.5 Plus
Dwil\GK22371-PA 342 GK22371-PA 1..241 19..265 691 49.6 Plus
Dwil\GK15228-PA 558 GK15228-PA 5..540 20..569 497 25.9 Plus
Dwil\GK22371-PA 342 GK22371-PA 236..324 489..577 218 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22053-PA 590 GE22053-PA 1..590 1..590 2965 96.9 Plus
Dyak\GE25646-PA 723 GE25646-PA 11..514 65..575 1442 51.4 Plus
Dyak\GE25645-PA 555 GE25645-PA 7..547 32..578 1237 46.4 Plus
Dyak\GE25646-PA 723 GE25646-PA 514..722 368..577 525 46.2 Plus
Dyak\GE13176-PA 460 GE13176-PA 7..451 89..564 400 27.7 Plus

RH67364.hyp Sequence

Translation from 202 to 1974

> RH67364.hyp
MATETTKMIYTPPPLDIKMEIEIGEQPQPPVKCSNFFANHWKGLVVFLVP
LLCLPVMLLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMG
IMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSP
RRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVLEELQAQGVCKINHEP
QYQIVGGNKKNNEDEPPYPTKITLCYYLGIAYASSLGGCGTIIGTATNLT
FKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRP
KSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMY
FTRKPGIFLGWADLLNSKDIRNSMPTIFVVVMCFMLPANYAFLRYCTRRG
GPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGN
ALIGLKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIEI
HPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTII
TIITLFVFCQTWGLVVYPNLNSFPEWAQIYAAAALGNKTH*

RH67364.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-PB 590 CG3979-PB 1..590 1..590 3089 100 Plus
Indy-PD 572 CG3979-PD 1..572 19..590 2994 100 Plus
Indy-PA 572 CG3979-PA 1..572 19..590 2994 100 Plus
Indy-PC 572 CG3979-PC 1..572 19..590 2994 100 Plus
CG33934-PE 556 CG33934-PE 16..555 32..577 1531 51.3 Plus