Clone RH68896 Report

Search the DGRC for RH68896

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:688
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG43693-RC
Protein status:RH68896.pep: gold
Sequenced Size:2176

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6327-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH68896.complete Sequence

2176 bp assembled on 2009-12-14

GenBank Submission: BT120035.1

> RH68896.complete
GATTCATTCGTCTGGTCGATGCCACAGCCATCGGCCACGTTGTCTTTGAA
TTCGATTTCGATTGCGTTGCGGCTATAGAAACTCGATCGCGATGTACAAG
AACATCGACAATGAGTCCTCCACGACCATGTTTGAAATGTACTCCTCCTC
GGATAGGTTCATACGTTCGGACATGGCCGACGTACCCGTGCAGCAGGCGG
CAGGATCGACGCTTCCGTTGGTAATCTCTCGGAAAAAAGGCGACGACTCC
GAGGATGGCAACTACAATCCGTTCGAGCACCGCAAGGTGGAGCATCCGAC
ATCGGATCTCGAGACATTTGTACACTTGCTAAAGGGATCGCTTGGCTCCG
GAATATTGGCCATGCCAATGGCCTTCTCCCACGCTGGATTGTGGTTCGGT
TTGGTGGCCACCTTCGCGGTGGGCACCTTGTGCACCTACTGCGTCCACAT
TCTGGTCAAGTGCGCCCACATCCTGTGCCGACGTCGTAAAATCCCGATGA
TGGGATTCGCCGATGTGGCGGAACAGGCTTTCCTCGACGGACCACCTGCC
CTGAATCGCTGGTCACGCTTCATCCGGTTCATGGTCAATACGTTTCTGGT
TATCGATTTGCTGGGCTGCTGCTGCATCTATCTGGTTTTCGTGGCCACCA
ATGTGGAGCAGGTCGTGCGGGTGTATATGGAAACGGAGCTGAGCATTAGA
GTTTGGATCATGATCGTGACGGCACCGCTAATCTTTATGTGCCTGGTACG
CAACCTGAAGTTCCTCACGCCCTTCTCGATGATAGCCAACATCCTGATGT
TCGTGGGCATCGTGATCACCTTCATCTATATGTTCTCCGATATTCCTGCA
CCCGTGGAACGTCCTGGAATTGTGAGTGTAACCGAATGGCCATTGTTCTT
CGGCACCGTGATCTTTGCTCTGGAGGGCATCGGTGTAGTTATGTCCCTGG
AGAACGACATGAAGAACCCCAGCCACTTCATCGGTTGCCCATCTGTCCTG
AACTTCGGCATGGGTCTGGTGATTGCCCTCTACACTCTGGTTGGATTCTT
TGGCTTCCTGAAGTACGGCCCGGAAACCCAGGCCAGCATTACGCTGAATC
TGCCCCTGGAGGATAAGTTGGCCCAATCCGTCAAGTTGATGATTGCCATC
GCCATCTTCTTCACCTTCACCCTGCAGTTCTACGTGCCCGTCACGATTTT
GTGGAAGGGTCTGGAGCACAAGATCCGGCCGGAGAAGCAGAACATCAGTG
AATACGGACTTCGTGTCTTTCTGGTGCTTCTGTGCGGCGGAATCGCAGTG
GCTCTGCCCAACTTGGGACCTTTCATCTCGCTAATTGGAGCGGTGTGCCT
GAGTACGCTGGGCATGATCGTTCCGGCGACCATTGAGCTGGCCGTGTATC
ATGAGGATCCCGGATACGGGCGCTTCAATTGGCGGCTGTGGAAGAACTCC
GGACTGATACTGTTCGGCGTGGTGGGTTTCGTGGCCGGAACCTATGTCAG
CATCATCGAATTCCACGCCGAATTCAGCAGCGGTCACTGAGAGATACTGC
TAATCTAATTTAACGTAGTCTTTAATGAAACTCTTCTAAGCACAGGGATG
TCTAAGTTAAGTTTTTAACTAATTTTAGGGCTAACCAAAGTTTTCTAGGA
CTCCGAAACCTCCCGCCTCGCCCCCTGGTTATCCTATCCCGCCCCATCCT
TTCCAACTCGATCCGCCACGATCCCTGATATATATATATATATATATCTA
TATATATGTATCCACATCCATAACCCCCATAGGGGGGTATCAGCAATCAA
ACAACAAAAGTATTTCGATTTAGTCGGTGCCACGCCCTCAAGGAGTTGCG
GCGGTGCGAAGGGGGCGTGGCATTAAGGTTACTTAGAGAATTCTTGTAGA
AGTGATTTTGTATCGTAGTGATTTTGACAACAACTTAGTCGTAATTAGTT
CCTACTCGAACTAAGCTAAAACAGACGGACGCAGCTGAAGTTTGTTTTCG
TTCTTCAATTATTTTGTTTTATCATTGATTTACTCTGTACATTATCGACG
CCCTAATTCAATAATCATGACATATTACCAATTACACAAATAACCGCTGT
CACCTTTAAAGGGGCAGCAAAAAAAATGGCATTAAAAAAAATAATAAAAC
TTTTTGAAACAAAAAAAAAAAAAAAA

RH68896.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6327-RC 2191 CG6327-RC 1..2161 1..2162 10770 99.9 Plus
CG6327.d 2176 CG6327.d 170..2174 157..2162 9990 99.9 Plus
CG6327.e 2869 CG6327.e 860..2864 157..2162 9990 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11027255..11028137 2160..1276 4280 99.4 Minus
chr3L 24539361 chr3L 11028512..11029326 1118..304 4075 100 Minus
chr3L 24539361 chr3L 11030509..11030812 304..1 1430 98 Minus
chr3L 24539361 chr3L 11028288..11028447 1276..1117 800 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RC 1449 CG43693-PC 1..1449 92..1540 7245 100 Plus
CG43693-RG 1719 CG43693-PG 336..1719 157..1540 6920 100 Plus
CG43693-RB 1509 CG43693-PB 126..1509 157..1540 6920 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:37:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RC 2163 CG43693-RC 1..2159 1..2160 10750 100 Plus
CG43693-RG 2434 CG43693-RG 428..2430 157..2160 9970 100 Plus
CG43693-RB 2399 CG43693-RB 393..2395 157..2160 9970 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PC 482 CG43693-PC 1..482 92..1537 2514 100 Plus
CG43693-PG 572 CG43693-PG 112..572 155..1537 2403 99.8 Plus
CG43693-PB 502 CG43693-PB 42..502 155..1537 2403 99.8 Plus
CG43693-PA 502 CG43693-PA 42..502 155..1537 2403 99.8 Plus
CG43693-PD 490 CG43693-PD 30..490 155..1537 2403 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11036360..11037245 2162..1276 4385 99.9 Minus
3L 28110227 3L 11037620..11038434 1118..304 4075 100 Minus
3L 28110227 3L 11039617..11039920 304..1 1520 100 Minus
3L 28110227 3L 11037396..11037555 1276..1117 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11029460..11030345 2162..1276 4395 99.8 Minus
3L 28103327 3L 11030720..11031534 1118..304 4075 100 Minus
3L 28103327 3L 11032717..11033020 304..1 1520 100 Minus
3L 28103327 3L 11030496..11030655 1276..1117 800 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:54:31 has no hits.

RH68896.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:48:08 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11030510..11030812 1..303 98   Minus
chr3L 11028514..11029326 304..1116 100 <- Minus
chr3L 11028288..11028447 1117..1276 100 <- Minus
chr3L 11027255..11028136 1277..2160 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:36 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RC 1..1449 92..1540 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:28 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RC 1..1449 92..1540 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:21:25 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 1..1449 92..1540 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:08 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 1..1449 92..1540 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:36 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RC 1..2159 1..2160 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:27 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RC 1..2159 1..2160 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:21:25 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 1..2159 1..2160 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:08 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 1..2159 1..2160 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:48:08 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11039618..11039920 1..303 100   Minus
3L 11037622..11038434 304..1116 100 <- Minus
3L 11037396..11037555 1117..1276 100 <- Minus
3L 11036362..11037244 1277..2160 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:21:25 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11032718..11033020 1..303 100   Minus
arm_3L 11030722..11031534 304..1116 100 <- Minus
arm_3L 11030496..11030655 1117..1276 100 <- Minus
arm_3L 11029462..11030344 1277..2160 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:17 Download gff for RH68896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11032718..11033020 1..303 100   Minus
3L 11030722..11031534 304..1116 100 <- Minus
3L 11030496..11030655 1117..1276 100 <- Minus
3L 11029462..11030344 1277..2160 99 <- Minus

RH68896.pep Sequence

Translation from 91 to 1539

> RH68896.pep
MYKNIDNESSTTMFEMYSSSDRFIRSDMADVPVQQAAGSTLPLVISRKKG
DDSEDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGL
WFGLVATFAVGTLCTYCVHILVKCAHILCRRRKIPMMGFADVAEQAFLDG
PPALNRWSRFIRFMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETEL
SIRVWIMIVTAPLIFMCLVRNLKFLTPFSMIANILMFVGIVITFIYMFSD
IPAPVERPGIVSVTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCP
SVLNFGMGLVIALYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLM
IAIAIFFTFTLQFYVPVTILWKGLEHKIRPEKQNISEYGLRVFLVLLCGG
IAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRLW
KNSGLILFGVVGFVAGTYVSIIEFHAEFSSGH*

RH68896.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23811-PA 644 GF23811-PA 151..644 1..482 2323 88.7 Plus
Dana\GF11466-PA 502 GF11466-PA 80..493 58..473 980 46.9 Plus
Dana\GF15226-PA 452 GF15226-PA 44..445 19..415 893 46 Plus
Dana\GF10626-PA 462 GF10626-PA 26..462 46..480 877 43.6 Plus
Dana\GF24851-PA 453 GF24851-PA 1..453 24..479 872 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13950-PA 616 GG13950-PA 125..616 1..482 2358 91.1 Plus
Dere\GG10546-PA 506 GG10546-PA 67..499 43..473 1017 46.3 Plus
Dere\GG22563-PA 477 GG22563-PA 43..468 45..473 982 46.4 Plus
Dere\GG14028-PA 519 GG14028-PA 78..515 45..482 890 43.5 Plus
Dere\GG14841-PA 451 GG14841-PA 13..451 39..479 877 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16577-PA 591 GH16577-PA 122..586 19..482 2200 87.7 Plus
Dgri\GH10379-PA 509 GH10379-PA 81..506 46..473 964 44.8 Plus
Dgri\GH22642-PA 479 GH22642-PA 14..456 18..460 943 42.9 Plus
Dgri\GH14926-PA 472 GH14926-PA 7..472 20..480 906 42.9 Plus
Dgri\GH15148-PA 470 GH15148-PA 24..464 38..479 905 42.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PC 482 CG43693-PC 1..482 1..482 2514 100 Plus
CG43693-PG 572 CG43693-PG 112..572 22..482 2403 99.8 Plus
CG43693-PB 502 CG43693-PB 42..502 22..482 2403 99.8 Plus
CG43693-PA 502 CG43693-PA 42..502 22..482 2403 99.8 Plus
CG43693-PD 490 CG43693-PD 30..490 22..482 2403 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13867-PA 592 GI13867-PA 126..587 22..482 2192 88.7 Plus
Dmoj\GI21155-PA 482 GI21155-PA 53..475 49..473 992 46.1 Plus
Dmoj\GI17357-PA 519 GI17357-PA 86..512 46..473 969 45.6 Plus
Dmoj\GI12085-PA 470 GI12085-PA 30..464 45..479 896 43.2 Plus
Dmoj\GI11443-PA 466 GI11443-PA 7..466 20..480 888 42.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15745-PA 618 GL15745-PA 157..618 22..482 2336 93.9 Plus
Dper\GL25941-PA 508 GL25941-PA 34..501 8..473 1020 44.6 Plus
Dper\GL11031-PA 477 GL11031-PA 51..474 53..479 961 45 Plus
Dper\GL15673-PA 479 GL15673-PA 13..479 26..480 888 43.4 Plus
Dper\GL17962-PA 435 GL17962-PA 30..422 45..471 796 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19514-PA 507 GA19514-PA 46..507 22..482 2325 93.9 Plus
Dpse\GA25197-PA 508 GA25197-PA 34..501 8..473 1020 44.6 Plus
Dpse\GA21321-PA 477 GA21321-PA 51..474 53..479 961 45 Plus
Dpse\GA17443-PA 469 GA17443-PA 30..456 45..471 907 43.8 Plus
Dpse\GA20662-PA 479 GA20662-PA 13..479 26..480 890 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24786-PA 440 GM24786-PA 40..431 20..411 1992 95.9 Plus
Dsec\GM16926-PA 508 GM16926-PA 76..501 49..473 1019 47.1 Plus
Dsec\GM20346-PA 474 GM20346-PA 49..465 55..473 974 46.3 Plus
Dsec\GM24863-PA 519 GM24863-PA 39..515 3..482 880 41 Plus
Dsec\GM14464-PA 451 GM14464-PA 22..451 48..479 878 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12836-PA 502 GD12836-PA 40..502 20..482 2367 96.3 Plus
Dsim\GD23535-PA 508 GD23535-PA 76..501 49..473 1014 46.9 Plus
Dsim\GD25825-PA 474 GD25825-PA 49..465 55..473 976 46.5 Plus
Dsim\GD13662-PA 451 GD13662-PA 22..451 48..479 884 41.6 Plus
Dsim\GD14275-PA 462 GD14275-PA 26..462 46..480 873 43.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11728-PA 601 GJ11728-PA 132..596 19..482 2190 87.1 Plus
Dvir\GJ18031-PA 518 GJ18031-PA 86..511 46..473 975 45.7 Plus
Dvir\GJ21005-PA 490 GJ21005-PA 56..466 45..460 936 45.4 Plus
Dvir\GJ13356-PA 471 GJ13356-PA 31..466 45..480 911 42.8 Plus
Dvir\GJ11930-PA 474 GJ11930-PA 35..470 44..479 894 41.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12679-PA 588 GK12679-PA 123..588 19..482 2276 91.6 Plus
Dwil\GK18413-PA 501 GK18413-PA 72..494 49..473 1006 46.9 Plus
Dwil\GK18659-PA 501 GK18659-PA 72..494 49..473 1005 46.9 Plus
Dwil\GK21740-PA 479 GK21740-PA 53..476 53..480 971 45.1 Plus
Dwil\GK11241-PA 488 GK11241-PA 52..488 46..480 906 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20249-PA 599 GE20249-PA 108..599 1..482 2424 93.3 Plus
Dyak\GE18766-PA 509 GE18766-PA 76..502 49..473 1013 46.7 Plus
Dyak\GE13433-PA 477 GE13433-PA 52..468 55..473 985 47 Plus
Dyak\GE21231-PA 519 GE21231-PA 78..513 45..480 876 42.8 Plus
Dyak\GE21779-PA 465 GE21779-PA 29..465 46..480 864 42.9 Plus

RH68896.hyp Sequence

Translation from 91 to 1539

> RH68896.hyp
MYKNIDNESSTTMFEMYSSSDRFIRSDMADVPVQQAAGSTLPLVISRKKG
DDSEDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGL
WFGLVATFAVGTLCTYCVHILVKCAHILCRRRKIPMMGFADVAEQAFLDG
PPALNRWSRFIRFMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETEL
SIRVWIMIVTAPLIFMCLVRNLKFLTPFSMIANILMFVGIVITFIYMFSD
IPAPVERPGIVSVTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCP
SVLNFGMGLVIALYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLM
IAIAIFFTFTLQFYVPVTILWKGLEHKIRPEKQNISEYGLRVFLVLLCGG
IAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRLW
KNSGLILFGVVGFVAGTYVSIIEFHAEFSSGH*

RH68896.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PC 482 CG43693-PC 1..482 1..482 2514 100 Plus
CG43693-PG 572 CG43693-PG 112..572 22..482 2403 99.8 Plus
CG43693-PB 502 CG43693-PB 42..502 22..482 2403 99.8 Plus
CG43693-PA 502 CG43693-PA 42..502 22..482 2403 99.8 Plus
CG43693-PD 490 CG43693-PD 30..490 22..482 2403 99.8 Plus