Clone RH69884 Report

Search the DGRC for RH69884

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:698
Well:84
Vector:pFlc-1
Associated Gene/TranscriptCG5281-RA
Protein status:RH69884.pep: gold
Sequenced Size:1598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5281 2008-02-01 Manual selection by Ken Wan
CG5281 2008-04-29 Picked prior to 5.5
CG5281 2008-12-18 5.12 accounting

Clone Sequence Records

RH69884.complete Sequence

1598 bp assembled on 2008-10-27

GenBank Submission: BT050556.1

> RH69884.complete
GATTCGCGAAAAGAATTAAAAATGTTTAATTAAACGCAGTCGGAGCGTGC
AAACAATGAATAAAACTCAGTGAAACTGGCGGCGGGGAAACGATGTGCCA
TTGAAAACGCAGAAAAGGCGGCAGCAGACAGTGACACAGCGCGTAAATAA
GGAAGGCAATCGAAAGAAATCGATTTTTCAGGGCAGGATGCTGAAACTTT
GAAGGAATCCAGAAACTGTAGAGAAGAAACCCCACAGAATGCCGGAAAAC
CTCGAGCTTCAGCAGTTCCAGGAGGGCGCCCCGCCCCCAGATCCCGCCCC
CCGTTGGCTGGAGCGCTTGCAGCGACGATTGGGCGCCGATTGTCCCTACT
TGGGTATCCTGCTGGCCACGCTCTCCTCGCTCTTCTTCTCCCTGTGCTCG
GTGATTGTGAAGGGACTGGTGGACGTGAACCCCATGGAGCTGGCCTCGTT
TCGATTCGTCGGAGTCCTGTTGCCGGCACTGCCCATCCTGATATACACGC
GACAGCCGGTGTTTCCGGAGGGCAAGAGGGTGATACTGCTGCTGCGCTGC
TTCATGGGCACAACGGGTCTGATGCTCAGCTTCTATGCCTTCCGACACAT
GCCCCTGGCCGATGCGAGTGTCATCATCTTCTCCACGCCCGTTTTCGTGG
CCATATTTGCGCGTGCCTTCCTCAAGGAGCCGTGTACGCTGTTCAATGTC
CTGACCATCAATATGACATTGCTCGGCGTGGTCCTCATCACGCGCCCACC
CTTTGTGTTCGGTGACACGGCGGAGAGTGAGGATGTCGCTGGGAAGACGT
ACGACATCTGGGGACCAGTGGCCGCCATATCATCCACACTCTTCGGAGCC
AATGTGTACATCCTGCTGCGGGCGCTCAAAAACCTGCACTTCTCCGTCAT
CATGACGAATTTCGGTACCATCGCTCTGGTCTACACACTGATCGTTTGCG
CATCTATTGGAGCTGTGTGCTGGCCAAGCTGCGGACGGGATCGTTGGCTG
GTCGTTGTACTGGGCGTATTCAGCTTCCTGGGCCAGATCCTGCTCACGCT
ATCGCTGCAGATCGAACAGGCCGGACCAGTGGCCATTGCTCGCTGCGCCG
ACATCGTCTTCGCCTTCGTCTGGCAGATGCTCTTCTTCGGAGAGACGCCC
ACCGCTTACTCGCTGGTGGGTGCGGTGATGGTGATGGGATCTGTGGTTCT
GACGGCCCTGAAGAAATGGGCAGGCACCCTGCCACGCGAGTCGTCGCTGC
GGAAGCGATTCAGGCTCATCCTGCTGGAATAGTGTGGTTCCAGAGCAACT
AAAAGAGTTCGCGGTTTCTCCCTCGTCTTGTCACATCGTTCTCACCCAAT
CCCGGCAAGCATCAGTGGCCGGCAGCAAACCCGGTTCATTCATCGTAGAC
TCTACTTATATCAAGGCTCAGATCGTAGATTAATCAAAATATATAAGAAG
GGACGCGTGATATCCACTCCACTCATAAGTAAATACTCGTAGTGCGTGTT
TAGTTTAGCCAATTTCGCCGATTTGTTGTTTTGTACATTGTTATACATGC
TTAAAATACGGTAATAAATACAACTTATGAATAAAAAAAAAAAAAAAA

RH69884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-RA 1711 CG5281-RA 131..1711 2..1582 7905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7261594..7262993 183..1582 7000 100 Plus
chr3R 27901430 chr3R 7261352..7261537 2..187 930 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-RA 1044 CG5281-PA 1..1044 239..1282 5220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:15 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-RA 1613 CG5281-RA 33..1613 2..1582 7905 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-PA 347 CG5281-PA 1..347 239..1279 1626 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11436124..11437533 183..1592 7035 99.9 Plus
3R 32079331 3R 11435882..11436067 2..187 930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11176955..11178364 183..1592 7035 99.9 Plus
3R 31820162 3R 11176713..11176898 2..187 930 100 Plus
Blast to na_te.dros performed on 2014-11-26 18:48:24 has no hits.

RH69884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:19:33 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7261598..7262993 187..1582 100   Plus
chr3R 7261351..7261536 1..186 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:23 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 1..1044 239..1282 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:28 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 1..1044 239..1282 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:23:32 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 1..1044 239..1282 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:33 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 1..1044 239..1282 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:57:27 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 11..1592 1..1582 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:27 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 32..1613 1..1582 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:23:32 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 32..1613 1..1582 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 16:51:15 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 11..1592 1..1582 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:33 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
CG5281-RA 32..1613 1..1582 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:19:33 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11436128..11437523 187..1582 100   Plus
3R 11435881..11436066 1..186 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:23:32 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7261850..7263245 187..1582 100   Plus
arm_3R 7261603..7261788 1..186 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:34 Download gff for RH69884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11176959..11178354 187..1582 100   Plus
3R 11176712..11176897 1..186 99 -> Plus

RH69884.pep Sequence

Translation from 238 to 1281

> RH69884.pep
MPENLELQQFQEGAPPPDPAPRWLERLQRRLGADCPYLGILLATLSSLFF
SLCSVIVKGLVDVNPMELASFRFVGVLLPALPILIYTRQPVFPEGKRVIL
LLRCFMGTTGLMLSFYAFRHMPLADASVIIFSTPVFVAIFARAFLKEPCT
LFNVLTINMTLLGVVLITRPPFVFGDTAESEDVAGKTYDIWGPVAAISST
LFGANVYILLRALKNLHFSVIMTNFGTIALVYTLIVCASIGAVCWPSCGR
DRWLVVVLGVFSFLGQILLTLSLQIEQAGPVAIARCADIVFAFVWQMLFF
GETPTAYSLVGAVMVMGSVVLTALKKWAGTLPRESSLRKRFRLILLE*

RH69884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18371-PA 348 GF18371-PA 1..337 1..336 1601 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18167-PA 347 GG18167-PA 1..347 1..347 1771 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17324-PA 348 GH17324-PA 1..333 1..332 1487 85.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-PA 347 CG5281-PA 1..347 1..347 1774 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10287-PA 348 GI10287-PA 1..348 1..347 1543 84.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12375-PA 329 GL12375-PA 1..318 1..336 1348 79.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18783-PA 347 GA18783-PA 1..336 1..336 1494 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23946-PA 347 GM23946-PA 1..347 1..347 1791 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18756-PA 347 GD18756-PA 1..347 1..347 1795 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11095-PA 349 GJ11095-PA 1..349 1..347 1559 85.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11296-PA 350 GK11296-PA 1..350 1..347 1570 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26098-PA 347 GE26098-PA 1..347 1..347 1719 98 Plus

RH69884.hyp Sequence

Translation from 238 to 1281

> RH69884.hyp
MPENLELQQFQEGAPPPDPAPRWLERLQRRLGADCPYLGILLATLSSLFF
SLCSVIVKGLVDVNPMELASFRFVGVLLPALPILIYTRQPVFPEGKRVIL
LLRCFMGTTGLMLSFYAFRHMPLADASVIIFSTPVFVAIFARAFLKEPCT
LFNVLTINMTLLGVVLITRPPFVFGDTAESEDVAGKTYDIWGPVAAISST
LFGANVYILLRALKNLHFSVIMTNFGTIALVYTLIVCASIGAVCWPSCGR
DRWLVVVLGVFSFLGQILLTLSLQIEQAGPVAIARCADIVFAFVWQMLFF
GETPTAYSLVGAVMVMGSVVLTALKKWAGTLPRESSLRKRFRLILLE*

RH69884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5281-PA 347 CG5281-PA 1..347 1..347 1774 100 Plus