Clone RH70883 Report

Search the DGRC for RH70883

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:708
Well:83
Vector:pFlc-1
Associated Gene/TranscriptAct88F-RA
Protein status:RH70883.pep: gold
Sequenced Size:1612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5178 2007-10-01 Manual selection by Ken Wan
Act88F 2008-04-29 Picked prior to 5.5
Act88F 2008-12-18 5.12 accounting

Clone Sequence Records

RH70883.complete Sequence

1612 bp assembled on 2008-10-27

GenBank Submission: BT050557.1

> RH70883.complete
GCTTTGTTGTTGAATCTAGTTGTCAACAGGAATCGAACGTGCGACTCTAT
CCAATTTTTCTCCTTTCGTTGACCTAAAAGATAAACAACTGCCAAGATGT
GTGACGATGATGCGGGTGCATTAGTTATCGACAACGGATCGGGCATGTGC
AAAGCCGGCTTCGCCGGTGATGACGCTCCCCGTGCTGTCTTCCCCTCAAT
TGTGGGTCGTCCCCGACACCAGGGTGTGATGGTGGGTATGGGTCAGAAGG
ACTCGTACGTGGGCGACGAGGCGCAAAGCAAGCGCGGTATCCTGACGCTG
AAGTACCCCATCGAGCACGGCATCATCACGAACTGGGACGACATGGAGAA
GATCTGGCATCACACCTTCTACAACGAGCTGCGCGTGGCCCCCGAGGAGC
ATCCAGTATTATTGACCGAGGCTCCACTGAACCCCAAGGCCAATCGCGAG
AAGATGACCCAGATCATGTTCGAGACCTTCAACTCGCCGGCCATGTACGT
GGCCATCCAGGCCGTGCTCTCCCTGTACGCCTCCGGTCGTACCACCGGTA
TTGTGCTGGACTCCGGCGATGGTGTCTCCCACACCGTGCCCATCTATGAG
GGCTTCGCCCTGCCCCACGCCATTCTGCGTCTGGATCTGGCTGGTCGCGA
TCTGACCGATTACCTGATGAAGATCCTGACGGAGCGCGGCTACAGCTTCA
CCACCACCGCCGAGCGTGAGATCGTGCGCGACATCAAGGAGAAGCTGTGC
TACGTGGCTCTGGACTTCGAGCAGGAGATGGCCACCGCTGCCGCCTCCAC
CTCGCTGGAGAAGTCGTACGAGTTGCCTGACGGCCAGGTGATCACCATTG
GCAACGAGCGCTTCCGCTGCCCCGAGGCTCTGTTCCAGCCCTCGTTCCTG
GGCATGGAGTCGTGCGGCATCCACGAGACCGTCTACAACTCGATCATGAA
GTGCGACGTGGACATCCGCAAGGATCTGTATGCCAACTCTGTGCTGTCCG
GCGGTACCACCATGTACCCTGGTATTGCCGATCGTATGCAGAAGGAGATC
ACTGCCCTGGCCCCATCGACCATCAAGATCAAGATCATTGCGCCACCCGA
GAGGAAGTACTCCGTCTGGATCGGTGGCTCCATCCTGGCCTCGCTGTCCA
CCTTCCAGCAGATGTGGATCTCGAAGCAGGAGTACGACGAGTCCGGCCCC
GGAATCGTTCACCGCAAATGCTTTTAAGTCTTTCGCCCGCCGCGAAAGCT
CTTCAAAGGCAGCAACCAGCAGCGACCAACAAGCACCCATCGAGCTACCC
AACAACCTCGGCTCGGACAGTGATAGACAAAAGCAGCGAACCCATCGCAC
AACAATTATCATCCAACTCAGATTCACAGCAGATAATCAGAGGCAACCTC
CGGTTGTCGGTGCTCATCCTTCATGGCCATTTCATCGGCAGCGGTATAGC
GGATTTTTACTTTGAAGAACTAATCGTAAGAGTCGTGGCTGTGCTCCATG
TCGAGTAGCAATCAAATGTATATGAGGAGCTTTTAACCCTAGTCAGTGAA
TTGAAAGCCAAATATATCTTCCATTAAAACTATTAAATATTTTAAATAAA
AAAAAAAAAAAA

RH70883.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-RA 1754 Act88F-RA 139..1736 3..1600 7990 100 Plus
Act79B-RA 1698 Act79B-RA 146..1244 130..1228 3875 90.1 Plus
Act87E-RA 1893 Act87E-RA 116..1253 91..1228 3830 89.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11265208..11266153 79..1024 4715 99.9 Plus
chr3R 27901430 chr3R 9251850..9252987 91..1228 3815 89 Plus
chr2R 21145070 chr2R 16831293..16832379 142..1228 3680 89.2 Plus
chrX 22417052 chrX 5795051..5796186 93..1228 3670 88.2 Plus
chr3L 24539361 chr3L 21974318..21975211 130..1023 3225 90.7 Plus
chr2R 21145070 chr2R 1901453..1902588 1228..93 3115 84.9 Minus
chr3R 27901430 chr3R 11266211..11266787 1021..1597 2885 100 Plus
chr3L 24539361 chr3L 21975571..21975778 1021..1228 665 88 Plus
chr3R 27901430 chr3R 11264589..11264666 3..80 390 100 Plus
chr2R 21145070 chr2R 12661960..12662207 415..662 265 73.8 Plus
chr2R 21145070 chr2R 12662388..12662548 855..1015 205 75.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-RA 1131 CG5178-PA 1..1131 97..1227 5655 100 Plus
Act79B-RB 1131 CG7478-PB 34..1131 130..1227 3870 90.2 Plus
Act79B-RA 1131 CG7478-PA 34..1131 130..1227 3870 90.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:38:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-RA 1595 CG5178-RA 1..1595 3..1597 7975 100 Plus
Act79B-RB 1619 CG7478-RB 175..1273 130..1228 3875 90.2 Plus
Act79B-RA 1543 CG7478-RA 99..1197 130..1228 3875 90.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-PA 376 CG5178-PA 1..376 97..1224 1968 100 Plus
Act87E-PC 376 CG18290-PC 1..376 97..1224 1936 97.6 Plus
Act87E-PB 376 CG18290-PB 1..376 97..1224 1936 97.6 Plus
Act87E-PA 376 CG18290-PA 1..376 97..1224 1936 97.6 Plus
Act57B-PA 376 CG10067-PA 1..376 97..1224 1933 97.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15440598..15441543 79..1024 4730 100 Plus
3R 32079331 3R 13426598..13427735 91..1228 3830 89.1 Plus
2R 25286936 2R 20944849..20945935 142..1228 3710 89.4 Plus
X 23542271 X 5902694..5903829 93..1228 3670 88.2 Plus
3L 28110227 3L 21985384..21986277 130..1023 3225 90.7 Plus
2R 25286936 2R 6014269..6015404 1228..93 3115 84.9 Minus
3R 32079331 3R 15441601..15442180 1021..1600 2900 100 Plus
3L 28110227 3L 21986637..21986844 1021..1228 665 88 Plus
3R 32079331 3R 15439969..15440046 3..80 390 100 Plus
2R 25286936 2R 16774750..16774997 415..662 265 73.8 Plus
2R 25286936 2R 16775178..16775338 855..1015 205 75.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15181429..15182374 79..1024 4730 100 Plus
3R 31820162 3R 13167429..13168566 91..1228 3830 89.1 Plus
2R 25260384 2R 20946048..20947134 142..1228 3710 89.4 Plus
X 23527363 X 5910792..5911927 93..1228 3670 88.2 Plus
3L 28103327 3L 21978484..21979377 130..1023 3225 90.7 Plus
2R 25260384 2R 6015468..6016603 1228..93 3115 84.9 Minus
3R 31820162 3R 15182432..15183011 1021..1600 2900 100 Plus
3L 28103327 3L 21979737..21979944 1021..1228 665 87.9 Plus
3R 31820162 3R 15180800..15180877 3..80 390 100 Plus
2R 25260384 2R 16776042..16776196 508..662 235 76.7 Plus
2R 25260384 2R 16775838..16775902 301..365 160 83 Plus
2R 25260384 2R 16776438..16776537 916..1015 155 77 Plus
Blast to na_te.dros performed on 2014-11-27 09:14:23 has no hits.

RH70883.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:16:25 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11266212..11266758 1022..1568 100 -> Plus
chr3R 11265210..11266150 81..1021 99 -> Plus
chr3R 11264585..11264666 1..80 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:53:40 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1131 97..1227 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:26 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1131 97..1227 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:21 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1131 97..1227 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:25 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1131 97..1227 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:57:26 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1572 22..1593 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:26 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1572 22..1593 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:21 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1595 3..1597 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 16:42:32 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1572 22..1593 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:25 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
Act88F-RA 1..1595 3..1597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:16:25 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15441602..15442177 1022..1597 100   Plus
3R 15440600..15441540 81..1021 100 -> Plus
3R 15439965..15440046 1..80 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:21 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11267324..11267899 1022..1597 100   Plus
arm_3R 11266322..11267262 81..1021 100 -> Plus
arm_3R 11265687..11265768 1..80 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:32 Download gff for RH70883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15182433..15183008 1022..1597 100   Plus
3R 15181431..15182371 81..1021 100 -> Plus
3R 15180796..15180877 1..80 97 -> Plus

RH70883.pep Sequence

Translation from 96 to 1226

> RH70883.pep
MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*

RH70883.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18300-PA 376 GF18300-PA 1..376 1..376 2030 100 Plus
Dana\GF17602-PA 376 GF17602-PA 1..376 1..376 1996 97.6 Plus
Dana\GF12208-PA 376 GF12208-PA 1..376 1..376 1991 97.3 Plus
Dana\GF10940-PA 376 GF10940-PA 1..376 1..376 1983 97.1 Plus
Dana\GF13827-PA 376 GF13827-PA 1..376 1..376 1968 95.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16929-PA 376 GG16929-PA 1..376 1..376 2030 100 Plus
Dere\GG19688-PA 376 GG19688-PA 1..376 1..376 1996 97.6 Plus
Dere\GG22068-PA 376 GG22068-PA 1..376 1..376 1991 97.3 Plus
Dere\GG16241-PA 376 GG16241-PA 1..376 1..376 1983 97.1 Plus
Dere\GG18797-PA 376 GG18797-PA 1..376 1..376 1980 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19077-PA 376 GH19077-PA 1..376 1..376 2022 99.7 Plus
Dgri\GH19045-PA 376 GH19045-PA 1..376 1..376 1996 97.6 Plus
Dgri\GH22007-PA 376 GH22007-PA 1..376 1..376 1991 97.3 Plus
Dgri\GH14437-PA 376 GH14437-PA 1..376 1..376 1983 97.1 Plus
Dgri\GH24372-PA 376 GH24372-PA 1..376 1..376 1980 96 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-PA 376 CG5178-PA 1..376 1..376 1968 100 Plus
Act87E-PC 376 CG18290-PC 1..376 1..376 1936 97.6 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1936 97.6 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1936 97.6 Plus
Act57B-PA 376 CG10067-PA 1..376 1..376 1933 97.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23222-PA 376 GI23222-PA 1..376 1..376 2022 99.7 Plus
Dmoj\GI24339-PA 376 GI24339-PA 1..376 1..376 1996 97.6 Plus
Dmoj\GI19711-PA 376 GI19711-PA 1..376 1..376 1991 97.3 Plus
Dmoj\GI13569-PA 376 GI13569-PA 1..376 1..376 1983 97.1 Plus
Dmoj\GI15312-PA 376 GI15312-PA 1..376 1..376 1980 96 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17061-PA 376 GL17061-PA 1..376 1..376 1991 97.3 Plus
Dper\GL14888-PA 376 GL14888-PA 1..376 1..376 1980 96 Plus
Dper\GL17787-PA 376 GL17787-PA 1..376 1..376 1979 95.7 Plus
Dper\GL26327-PA 376 GL26327-PA 1..376 1..376 1930 93.9 Plus
Dper\GL23756-PA 371 GL23756-PA 1..371 1..376 1733 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26730-PA 376 GA26730-PA 1..376 1..376 2030 100 Plus
Dpse\GA14877-PB 376 GA14877-PB 1..376 1..376 1996 97.6 Plus
Dpse\GA14877-PA 376 GA14877-PA 1..376 1..376 1996 97.6 Plus
Dpse\GA24346-PA 376 GA24346-PA 1..376 1..376 1991 97.3 Plus
Dpse\GA20380-PA 376 GA20380-PA 1..376 1..376 1983 97.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22426-PA 376 GM22426-PA 1..376 1..376 1983 97.1 Plus
Dsec\GM12447-PA 376 GM12447-PA 1..376 1..376 1980 96 Plus
Dsec\GM16492-PA 376 GM16492-PA 1..376 1..376 1975 95.5 Plus
Dsec\GM24109-PA 376 GM24109-PA 1..376 1..376 1962 96.3 Plus
Dsec\GM21720-PA 376 GM21720-PA 12..376 7..376 1328 64.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Act88F-PA 376 GD19025-PA 1..376 1..376 2030 100 Plus
Dsim\GD18909-PA 376 GD18909-PA 1..376 1..376 1996 97.6 Plus
Dsim\GD11548-PA 376 GD11548-PA 1..376 1..376 1991 97.3 Plus
Dsim\GD15015-PA 376 GD15015-PA 1..376 1..376 1983 97.1 Plus
Dsim\GD16764-PA 376 GD16764-PA 1..376 1..376 1980 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\ActE2-PA 376 GJ22881-PA 1..376 1..376 2022 99.7 Plus
Dvir\ActE1-PA 376 GJ10425-PA 1..376 1..376 1996 97.6 Plus
Dvir\ActC2-PA 376 GJ17479-PA 1..376 1..376 1991 97.3 Plus
Dvir\ActD1-PA 376 GJ13903-PA 1..376 1..376 1983 97.1 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 1..376 1..376 1980 96 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11462-PA 376 GK11462-PA 1..376 1..376 2030 100 Plus
Dwil\GK13943-PA 376 GK13943-PA 1..376 1..376 1996 97.6 Plus
Dwil\GK23336-PA 376 GK23336-PA 1..376 1..376 1991 97.3 Plus
Dwil\GK10683-PA 376 GK10683-PA 1..376 1..376 1983 97.1 Plus
Dwil\GK20124-PA 376 GK20124-PA 1..376 1..376 1980 96 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24312-PA 376 GE24312-PA 1..376 1..376 2030 100 Plus
Dyak\GE26273-PA 376 GE26273-PA 1..376 1..376 1996 97.6 Plus
Dyak\GE12149-PA 376 GE12149-PA 1..376 1..376 1991 97.3 Plus
Dyak\Act57B-PA 376 GE17558-PA 1..376 1..376 1980 96 Plus
Dyak\GE19434-PA 376 GE19434-PA 1..376 1..376 1979 95.7 Plus

RH70883.hyp Sequence

Translation from 96 to 1226

> RH70883.hyp
MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*

RH70883.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Act88F-PA 376 CG5178-PA 1..376 1..376 1968 100 Plus
Act87E-PC 376 CG18290-PC 1..376 1..376 1936 97.6 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1936 97.6 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1936 97.6 Plus
Act57B-PA 376 CG10067-PA 1..376 1..376 1933 97.3 Plus