Clone RH74790 Report

Search the DGRC for RH74790

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:747
Well:90
Vector:pFlc-1
Associated Gene/TranscriptEla-RB
Protein status:RH74790.pep: gold
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ela-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RH74790.complete Sequence

1142 bp assembled on 2010-12-06

GenBank Submission: BT125814.1

> RH74790.complete
GAGTGTACCCAAAGACGCCATGTTAAGCAGGAGGGTCATCGCATTCGCCG
CTCTGGCCCTCATCCAGATAGCCAGCGGTCAGGCCTCGCAATTCAGCAGG
GACGAAAGTCAGGAGGATCAGAAGACGGAGTTTAACCTGGCCTCCACTCT
GACGGGAGGCATTACCAGCAGTCGCCATCGCCAGCGGGCCAATCTCAATT
CGCAACTTTATCCTGGCCTTGGTCAGCTGGGATCGGGTTATGCGGGCGCA
ACTGGATCCATCGACGATGCCCATGGCCATGAGCAGGGTGGCTCTGGCGT
ACGAGTGGCCAGAGGTCACCAGATTCCCGCTTATCCGCCTCCGGGTTTTC
CTGGACAACAGGCTCCAGTTCCGTACCCAGCTGCAGGAGGCTCTTCAGGA
GGATCCTCATCATCCGGTGGTTACCAAAGTGCAGGTGCTGTTTCTCCTCC
TGGCTATCCTGTTGCTGGAGCAGTTCCTGCTCAGTATCCGGTGGGAGTTC
CTCCCCAGCAGCCAGTGGGTGCAGGAGCACCTGGTTACTTCCCGGGAACT
GGTGCCTATCCTGGCTATCCCTACCCCGGAGTATACTTGCCACAGTACCC
AGCGTACCCTCAACCAGCCCAGTTCCCCGCCTATGGAGTGCTACCCGGAG
CTGTGGCTCAACCAGGAGTTCCTGGAGTAGCTGGAGTTCCGGGAGCACCT
GGAGTGGCAGGAGTGCCCGGAGCAGCTGGTCAGGCTCCTGCCACCAGCGG
CATGAACTATCATCGCTATCCGGCTCACAATCCCGCTGATCCGAGCCATT
GGGACCATCATTTCTCGATGAACACCGAGTACAAGGAGGATGGCGTCCAC
AAGGGACCATTTGGAGTGCTGAACAATCACAATGCCTTTGGCTATGGCAG
TGGATATGGGGGCGGATACAACGGTGCCTTCAACTCGCCGGCCTACTGAA
GCTGGCCGACATCATGGGTGGACCTCGGTGGTGGTGGTAGTGGTAATGGT
GTTGGTGGGGCGTGAAGTAATCCGAGTCGTAGTCATAACTTCGCTGCTGC
CTCCTTGGCCAGAGGCAGCTGTCTTTGCCTATCATCCTGTGTGTCCCTGC
GAAATAAACTTGATTTCTGCACACCCAAAAAAAAAAAAAAAA

RH74790.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20689196..20689889 433..1126 3470 100 Plus
chr3R 27901430 chr3R 20688538..20688848 2..312 1555 100 Plus
chr3R 27901430 chr3R 20688908..20689032 312..436 625 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-RB 930 CG7021-PB 1..930 20..949 4650 100 Plus
Ela-RC 990 CG7021-PC 353..990 312..949 3190 100 Plus
Ela-RA 990 CG7021-PA 353..990 312..949 3190 100 Plus
Ela-RC 990 CG7021-PC 1..293 20..312 1465 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-RB 1127 CG7021-RB 3..1127 2..1126 5625 100 Plus
Ela-RC 2135 CG7021-RC 373..1187 312..1126 4075 100 Plus
Ela-RA 1187 CG7021-RA 373..1187 312..1126 4075 100 Plus
Ela-RC 2135 CG7021-RC 3..313 2..312 1555 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-PB 309 CG7021-PB 1..120 20..379 557 100 Plus
Ela-PC 329 CG7021-PC 1..140 20..379 520 85 Plus
Ela-PA 329 CG7021-PA 1..140 20..379 520 85 Plus
Ela-PB 309 CG7021-PB 242..287 743..880 277 100 Plus
Ela-PC 329 CG7021-PC 262..307 743..880 277 100 Plus
Ela-PA 329 CG7021-PA 262..307 743..880 277 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24866010..24866705 433..1128 3480 100 Plus
3R 32079331 3R 24865352..24865662 2..312 1555 100 Plus
3R 32079331 3R 24865722..24865846 312..436 625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24606841..24607536 433..1128 3480 100 Plus
3R 31820162 3R 24606183..24606493 2..312 1555 100 Plus
3R 31820162 3R 24606553..24606677 312..436 625 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:32:02 has no hits.

RH74790.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:03 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20689198..20689889 435..1126 95   Plus
chr3R 20688908..20689030 312..434 100 -> Plus
chr3R 20688537..20688847 1..311 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 17:16:16 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 1..930 20..949 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:30 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 1..930 20..949 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:03 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 1..930 20..949 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 17:16:16 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 2..1126 2..1126 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:30 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 2..1127 1..1126 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:03 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
Ela-RB 2..1127 1..1126 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:03 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24866012..24866703 435..1126 100   Plus
3R 24865722..24865844 312..434 100 -> Plus
3R 24865351..24865661 1..311 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:30 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20691734..20692425 435..1126 100   Plus
arm_3R 20691444..20691566 312..434 100 -> Plus
arm_3R 20691073..20691383 1..311 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:08 Download gff for RH74790.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24606843..24607534 435..1126 100   Plus
3R 24606553..24606675 312..434 100 -> Plus
3R 24606182..24606492 1..311 99 -> Plus

RH74790.hyp Sequence

Translation from 0 to 948

> RH74790.hyp
SVPKDAMLSRRVIAFAALALIQIASGQASQFSRDESQEDQKTEFNLASTL
TGGITSSRHRQRANLNSQLYPGLGQLGSGYAGATGSIDDAHGHEQGGSGV
RVARGHQIPAYPPPGFPGQQAPVPYPAAGGSSGGSSSSGGYQSAGAVSPP
GYPVAGAVPAQYPVGVPPQQPVGAGAPGYFPGTGAYPGYPYPGVYLPQYP
AYPQPAQFPAYGVLPGAVAQPGVPGVAGVPGAPGVAGVPGAAGQAPATSG
MNYHRYPAHNPADPSHWDHHFSMNTEYKEDGVHKGPFGVLNNHNAFGYGS
GYGGGYNGAFNSPAY*

RH74790.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-PB 309 CG7021-PB 1..309 7..315 1684 100 Plus
Ela-PC 329 CG7021-PC 1..329 7..315 1647 93.6 Plus
Ela-PA 329 CG7021-PA 1..329 7..315 1647 93.6 Plus
Cpr47Ef-PD 601 CG13214-PD 356..548 72..256 175 34.4 Plus
Cpr47Ef-PC 612 CG13214-PC 356..559 72..256 166 33.3 Plus

RH74790.pep Sequence

Translation from 1 to 948

> RH74790.pep
SVPKDAMLSRRVIAFAALALIQIASGQASQFSRDESQEDQKTEFNLASTL
TGGITSSRHRQRANLNSQLYPGLGQLGSGYAGATGSIDDAHGHEQGGSGV
RVARGHQIPAYPPPGFPGQQAPVPYPAAGGSSGGSSSSGGYQSAGAVSPP
GYPVAGAVPAQYPVGVPPQQPVGAGAPGYFPGTGAYPGYPYPGVYLPQYP
AYPQPAQFPAYGVLPGAVAQPGVPGVAGVPGAPGVAGVPGAAGQAPATSG
MNYHRYPAHNPADPSHWDHHFSMNTEYKEDGVHKGPFGVLNNHNAFGYGS
GYGGGYNGAFNSPAY*

RH74790.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16999-PA 290 GF16999-PA 1..287 7..312 694 59.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11330-PA 349 GG11330-PA 12..349 1..315 1222 82.3 Plus
Dere\GG11329-PA 167 GG11329-PA 12..81 1..83 292 75.9 Plus
Dere\GG11329-PA 167 GG11329-PA 81..156 174..257 249 69 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17061-PA 316 GH17061-PA 7..316 11..315 441 42.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Ela-PB 309 CG7021-PB 1..309 7..315 1684 100 Plus
Ela-PC 329 CG7021-PC 1..329 7..315 1647 93.6 Plus
Ela-PA 329 CG7021-PA 1..329 7..315 1647 93.6 Plus
Cpr47Ef-PD 601 CG13214-PD 356..548 72..256 175 34.4 Plus
Cpr47Ef-PC 612 CG13214-PC 356..559 72..256 166 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10571-PA 266 GI10571-PA 2..266 10..315 320 40.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13939-PA 298 GL13939-PA 1..298 7..315 503 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20038-PC 307 GA20038-PC 1..307 7..315 495 53.2 Plus
Dpse\GA20038-PD 328 GA20038-PD 1..328 7..315 488 50.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26638-PA 244 GM26638-PA 59..244 139..315 737 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21140-PA 262 GD21140-PA 48..262 106..315 808 88.6 Plus
Dsim\GD15184-PA 159 GD15184-PA 12..159 1..128 560 77.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22927-PA 68 GJ22927-PA 20..63 27..70 178 72.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22428-PA 277 GK22428-PA 8..275 18..313 478 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23525-PA 333 GE23525-PA 12..333 1..315 1198 84.7 Plus