Clone RT01137 Report

Search the DGRC for RT01137

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:11
Well:37
Vector:pCR2.1
Associated Gene/TranscriptCG15269-RA
Protein status:RT01137.pep: gold
Sequenced Size:1796

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15269 2006-05-19 RT target
CG15269 2008-08-15 Release 5.9 accounting
CG15269 2008-12-18 5.12 accounting

Clone Sequence Records

RT01137.complete Sequence

1796 bp assembled on 2008-11-04

GenBank Submission: BT029288.2

> RT01137.complete
GAAGTTATCAGTCGACATGCTGCAGCGCAGTTACGACCTTTCGCCCTCGC
CGGCGCGTACTTCACCCACCAATGGAGTCCAGAACTTGGGAGCTGGGGCA
CAGTTGCCACCGGCTCAAGTCACTGACTTTAGCATCAGTAAGATTCTGGG
CAAGGAGCGTAAATCCGCTCAGGATACGAGCACGAATATCCTGGATCTAT
CCAAGAGCAGTAGCAACAGTATTAGGAGCCCACAGGCTCTTGGAGGGCTG
GCAATACCATCAACTCCTTATGCCTCCGGTGCCTACTCCATGTTGCCGCC
AGATTTGGTGGCCATGGCCAATGCCACCAAGTTCTATGCCCAATTCTTCC
CGCACTTACTGCCCGCCTATGCGGCTGCTGCAGCGGCTGCCGGCTTGAGT
ACTCCTCCTACGTCGCCCTATCAAACACATCAGCATCAGCAGCATTTGCC
AAATCAGCAGAAACGCTTCTTTGCTCCCTATGTGATCAATGGATCGGTTC
CCCCACCACCACCACTGCAGCAGCAACAGCAACCTCTCATACGCACCAAA
AGCACCGCATGCACTCGTCCGGATTGCCCGGAGTGCCTGGATTATTACCA
AAGATTGCAGACTGGTGGCTATAAGCAGACCGCACCTCTCATCTCACCCG
CCGCCTCCTCGGTGAGCAGTTCCACCGGATCAATACGTCCTGTGAGGGAT
CTGATTATGAGTGCCACTGGAGGAGCCGCCAGCACTAACATCTCACTGAC
CACCGTGACCAATCTGAGTCTGAACTCGGTCCAGGCAACGGCCGTCGGAA
TGATGCCCAAGATGACCGGTGGACTGATCACCACAGCCGTCGGCAGCAAC
AGTGGAGCAATCGGTGGTATCGGTGGATACAATGCCACATCCGCCGAGGA
GATCAGCTACAAGTGCCGGATTTGCGAGAAGGTATTCGGATGCTCTGAAA
CTCTGCAGGCTCATGAAAAGACGCACAAATCGCCGCGTTACGAGTGTGCG
GATTGTGGAAAGGGTTTCTCCCAGCTGCGAAATTACAAATATCACCTGTC
CGTTCACCGAGGAACCAAGGAGTTTGCCGCCGAGTGTCCCGAATGTGGCA
AGACATTCAACGATAAGGGATATTTGAGCAGTCACCTAAAGATTCACCGG
AACCGGAAGGAGTACGAGTGTCCTTACTGTCCCAAATCGTTCAATCAGCG
TGTGGCCTTCAATATGCATGTCCGGATTCATACCGGCGTGAAACCCCACA
AATGCAACGAGTGCGGAAAGAGATTTTCGCGTAAAATGCTGCTCAAACAG
CACATGAGGACGCACAGTGGTGAGAAACCGTATCAGTGCTCCGTGTGCGG
CAAGTCCTTTGCCGATCGCAGCAACATGACCCTGCACCATCGCCTCCACT
CGGGAATCAAGCCCTTCAGCTGCCCCCTGTGCCCCAAAGCCTTCACCAAA
AAGCATCACCTAAAGACGCATCTGAATTACCATACAGGCTGCAAGCCGTA
TGTCTGCCCACATCCCAACTGCAATCAGGCATTCACCCAGTCGAGCAATA
TGCGAACCCACGCTAAGAAGTGTCAGTACCGTCCGTTGGATGGACTCACG
GTCACATCATCCGCACTTCCAGTACCGGGAAAACAACAAACAGGTCCACC
GCCCACTTTGGCCATGGCCATGGCTCAAACATTTCAAATGCCGCCACCTC
CTGGAGTTCTAACACCTGGATCTGGTCCATCCCAACCGCCGAGTCAGCAA
ACCCTTCTCAGCAATCTCAGGACATTCTAAAAGCTTTATCGACCAT

RT01137.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-RA 2145 CG15269-RA 180..1945 16..1781 8830 100 Plus
CG15269.a 2316 CG15269.a 373..2138 16..1781 8830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15108375..15109318 16..959 4720 100 Plus
chr2L 23010047 chr2L 15110881..15111706 956..1781 4115 99.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-RA 1764 CG15269-PA 1..1764 17..1780 8820 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:41:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-RA 2122 CG15269-RA 180..1945 16..1781 8830 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-PA 587 CG15269-PA 1..587 17..1777 2741 100 Plus
crol-PC 756 CG14938-PC 106..429 710..1573 461 31.9 Plus
Meics-PB 571 CG8474-PB 262..474 914..1561 459 37.8 Plus
Meics-PA 583 CG8474-PA 274..486 914..1561 459 37.8 Plus
crol-PH 686 CG14938-PH 106..430 710..1573 454 31.5 Plus
Meics-PB 571 CG8474-PB 309..544 887..1585 431 36.2 Plus
Meics-PA 583 CG8474-PA 321..556 887..1585 431 36.2 Plus
Meics-PB 571 CG8474-PB 285..506 899..1567 396 32.3 Plus
Meics-PA 583 CG8474-PA 297..518 899..1567 396 32.3 Plus
Meics-PB 571 CG8474-PB 341..567 899..1483 363 31.9 Plus
Meics-PA 583 CG8474-PA 353..579 899..1483 363 31.9 Plus
crol-PC 756 CG14938-PC 292..533 899..1516 351 32.7 Plus
Meics-PB 571 CG8474-PB 230..392 1085..1567 304 33.9 Plus
Meics-PA 583 CG8474-PA 242..404 1085..1567 304 33.9 Plus
Meics-PB 571 CG8474-PB 428..571 908..1327 219 29.7 Plus
Meics-PA 583 CG8474-PA 440..583 908..1327 219 29.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15109584..15110527 16..959 4720 100 Plus
2L 23513712 2L 15112090..15112915 956..1781 4130 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15109584..15110527 16..959 4720 100 Plus
2L 23513712 2L 15112090..15112915 956..1781 4130 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:42:43 has no hits.

RT01137.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:31:12 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15110884..15111706 959..1781 99   Plus
chr2L 15108362..15109317 4..958 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:55:39 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:08 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:52 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-11-04 14:48:34 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:12 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:23 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:08 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:52 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 167..1945 4..1781 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:48:34 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1764 17..1780 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:12 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 167..1945 4..1781 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:31:12 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15112093..15112915 959..1781 100   Plus
2L 15109571..15110526 4..958 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:52 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15112093..15112915 959..1781 100   Plus
arm_2L 15109571..15110526 4..958 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:20 Download gff for RT01137.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15112093..15112915 959..1781 100   Plus
2L 15109571..15110526 4..958 99 -> Plus

RT01137.pep Sequence

Translation from 1 to 1779

> RT01137.pep
KLSVDMLQRSYDLSPSPARTSPTNGVQNLGAGAQLPPAQVTDFSISKILG
KERKSAQDTSTNILDLSKSSSNSIRSPQALGGLAIPSTPYASGAYSMLPP
DLVAMANATKFYAQFFPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLP
NQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTRPDCPECLDYYQ
RLQTGGYKQTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAASTNISLT
TVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEE
ISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLS
VHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQR
VAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCG
KSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPY
VCPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVPGKQQTGPP
PTLAMAMAQTFQMPPPPGVLTPGSGPSQPPSQQTLLSNLRTF*

RT01137.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14340-PA 593 GF14340-PA 7..593 6..592 2108 76.5 Plus
Dana\GF10403-PA 578 GF10403-PA 267..479 305..520 411 37.8 Plus
Dana\GF23400-PA 940 GF23400-PA 392..630 303..543 398 35.7 Plus
Dana\GF23400-PA 940 GF23400-PA 333..564 300..526 388 34.3 Plus
Dana\GF23400-PA 940 GF23400-PA 280..497 303..523 388 34.7 Plus
Dana\GF16427-PA 883 GF16427-PA 283..505 303..523 388 35 Plus
Dana\GF24085-PA 979 GF24085-PA 651..848 332..528 388 37.6 Plus
Dana\GF10403-PA 578 GF10403-PA 323..548 305..528 380 37.4 Plus
Dana\GF23400-PA 940 GF23400-PA 188..469 267..523 369 30.8 Plus
Dana\GF10403-PA 578 GF10403-PA 290..511 300..522 352 32.7 Plus
Dana\GF23400-PA 940 GF23400-PA 226..421 332..527 291 33.7 Plus
Dana\GF10403-PA 578 GF10403-PA 234..425 362..522 283 28.9 Plus
Dana\GF10403-PA 578 GF10403-PA 362..572 288..495 279 33.2 Plus
Dana\GF23400-PA 940 GF23400-PA 501..698 300..465 221 30.8 Plus
Dana\GF16427-PA 883 GF16427-PA 356..507 287..438 209 29.9 Plus
Dana\GF16427-PA 883 GF16427-PA 397..515 300..420 166 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25148-PA 606 GG25148-PA 7..606 6..592 2590 90.3 Plus
Dere\GG13746-PA 574 GG13746-PA 262..477 302..520 417 37.7 Plus
Dere\GG13746-PA 574 GG13746-PA 312..547 296..528 386 36.7 Plus
Dere\GG10297-PA 612 GG10297-PA 55..306 290..543 384 34.5 Plus
Dere\GG12054-PA 872 GG12054-PA 297..491 328..523 384 35.9 Plus
Dere\GG15916-PA 977 GG15916-PA 637..824 332..523 381 37 Plus
Dere\GG10297-PA 612 GG10297-PA 1..257 268..523 379 32.7 Plus
Dere\GG10297-PA 612 GG10297-PA 149..373 300..522 368 36.1 Plus
Dere\GG13746-PA 574 GG13746-PA 233..423 332..522 356 35.8 Plus
Dere\GG10297-PA 612 GG10297-PA 40..240 330..526 355 35.1 Plus
Dere\GG13746-PA 574 GG13746-PA 288..509 300..522 336 32.7 Plus
Dere\GG13746-PA 574 GG13746-PA 332..571 288..495 311 30.2 Plus
Dere\GG12054-PA 872 GG12054-PA 332..490 304..464 255 32.1 Plus
Dere\GG12054-PA 872 GG12054-PA 293..432 382..520 234 33.6 Plus
Dere\GG10297-PA 612 GG10297-PA 177..374 300..465 219 30.8 Plus
Dere\GG12054-PA 872 GG12054-PA 342..493 287..438 209 29.9 Plus
Dere\GG13746-PA 574 GG13746-PA 431..574 303..442 184 30.3 Plus
Dere\GG12054-PA 872 GG12054-PA 383..501 300..420 166 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10919-PA 579 GH10919-PA 27..576 6..592 1675 64.2 Plus
Dgri\GH13073-PA 979 GH13073-PA 421..659 303..543 400 35.7 Plus
Dgri\GH13073-PA 979 GH13073-PA 362..593 300..526 389 34.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 309..526 303..523 389 34.7 Plus
Dgri\GH18613-PA 627 GH18613-PA 345..586 302..520 385 32.9 Plus
Dgri\GH18105-PA 918 GH18105-PA 276..498 303..523 382 33.6 Plus
Dgri\GH13680-PA 384 GH13680-PA 181..379 295..494 373 36.8 Plus
Dgri\GH18613-PA 627 GH18613-PA 369..590 273..494 371 34.4 Plus
Dgri\GH13073-PA 979 GH13073-PA 502..726 300..522 369 36.5 Plus
Dgri\GH13680-PA 384 GH13680-PA 185..375 326..520 350 34.4 Plus
Dgri\GH13073-PA 979 GH13073-PA 255..450 332..527 293 33.7 Plus
Dgri\GH13073-PA 979 GH13073-PA 530..727 300..465 220 30.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-PA 587 CG15269-PA 1..587 6..592 3153 100 Plus
crol-PC 756 CG14938-PC 85..429 205..524 483 30.7 Plus
crol-PH 686 CG14938-PH 85..430 205..524 476 30.4 Plus
crol-PG 878 CG14938-PG 86..466 164..523 476 29.7 Plus
Meics-PB 571 CG8474-PB 262..474 305..520 459 37.8 Plus
crol-PG 878 CG14938-PG 330..551 300..524 439 35.8 Plus
crol-PC 756 CG14938-PC 292..516 300..522 421 36.1 Plus
crol-PG 878 CG14938-PG 414..638 300..522 421 36.1 Plus
crol-PH 686 CG14938-PH 265..471 300..502 371 35.9 Plus
crol-PH 686 CG14938-PH 293..488 300..489 349 36.2 Plus
crol-PC 756 CG14938-PC 320..518 300..466 255 29.9 Plus
crol-PG 878 CG14938-PG 442..640 300..466 255 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13302-PA 606 GI13302-PA 7..606 6..592 1695 62.9 Plus
Dmoj\GI10527-PA 897 GI10527-PA 272..494 303..523 403 35.4 Plus
Dmoj\GI17692-PA 965 GI17692-PA 405..643 303..543 398 35.7 Plus
Dmoj\GI17692-PA 965 GI17692-PA 346..577 300..526 387 34.3 Plus
Dmoj\GI17692-PA 965 GI17692-PA 293..510 303..523 387 34.7 Plus
Dmoj\GI10361-PA 595 GI10361-PA 312..553 302..520 375 32.9 Plus
Dmoj\GI14705-PA 529 GI14705-PA 170..391 300..520 374 34.5 Plus
Dmoj\GI17692-PA 965 GI17692-PA 486..710 300..522 367 36.5 Plus
Dmoj\GI17692-PA 965 GI17692-PA 206..451 267..520 359 32.9 Plus
Dmoj\GI14705-PA 529 GI14705-PA 147..308 362..522 303 37.8 Plus
Dmoj\GI17692-PA 965 GI17692-PA 239..434 332..527 290 33.7 Plus
Dmoj\GI14705-PA 529 GI14705-PA 143..279 386..522 242 33.8 Plus
Dmoj\GI17692-PA 965 GI17692-PA 514..711 300..465 219 30.8 Plus
Dmoj\GI10527-PA 897 GI10527-PA 345..496 287..438 212 29.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26031-PA 597 GL26031-PA 7..597 6..592 1979 72 Plus
Dper\GL20488-PA 270 GL20488-PA 34..263 290..522 406 37.2 Plus
Dper\GL26275-PA 880 GL26275-PA 412..635 303..523 402 38.6 Plus
Dper\GL20489-PA 360 GL20489-PA 96..353 276..522 395 35.5 Plus
Dper\GL20488-PA 270 GL20488-PA 5..207 317..522 394 39.6 Plus
Dper\GL16107-PA 352 GL16107-PA 61..289 288..522 390 35.3 Plus
Dper\GL16107-PA 352 GL16107-PA 129..344 303..521 375 35.5 Plus
Dper\GL16107-PA 352 GL16107-PA 48..261 303..522 360 35.7 Plus
Dper\GL20488-PA 270 GL20488-PA 75..267 303..496 354 37.9 Plus
Dper\GL16107-PA 352 GL16107-PA 47..296 329..579 330 30 Plus
Dper\GL20489-PA 360 GL20489-PA 177..356 315..495 321 35.7 Plus
Dper\GL20488-PA 270 GL20488-PA 3..151 372..522 320 41.1 Plus
Dper\GL20489-PA 360 GL20489-PA 178..356 288..467 316 38.7 Plus
Dper\GL20488-PA 270 GL20488-PA 2..121 399..520 242 36.9 Plus
Dper\GL20488-PA 270 GL20488-PA 131..269 303..442 235 36.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13615-PA 599 GA13615-PA 7..599 6..592 1961 71.4 Plus
Dpse\GA26117-PA 423 GA26117-PA 132..360 288..522 397 35.3 Plus
Dpse\GA25545-PB 362 GA25545-PB 77..355 267..522 396 34.2 Plus
Dpse\GA13064-PA 871 GA13064-PA 260..482 303..523 387 35 Plus
Dpse\GA26117-PA 423 GA26117-PA 200..415 303..521 382 35.5 Plus
Dpse\GA28104-PA 368 GA28104-PA 91..338 296..523 375 33.7 Plus
Dpse\GA26117-PA 423 GA26117-PA 119..332 303..522 368 35.7 Plus
Dpse\GA28104-PA 368 GA28104-PA 68..307 303..520 359 32.6 Plus
Dpse\GA28104-PA 368 GA28104-PA 5..281 296..522 352 31.2 Plus
Dpse\GA28104-PA 368 GA28104-PA 121..344 296..494 347 32.6 Plus
Dpse\GA26117-PA 423 GA26117-PA 118..367 329..579 333 30 Plus
Dpse\GA25545-PB 362 GA25545-PB 179..358 315..495 320 35.7 Plus
Dpse\GA28104-PA 368 GA28104-PA 2..204 321..522 317 33.3 Plus
Dpse\GA26117-PA 423 GA26117-PA 228..419 303..495 316 37.1 Plus
Dpse\GA25545-PB 362 GA25545-PB 180..358 288..467 315 38.7 Plus
Dpse\GA28104-PA 368 GA28104-PA 1..123 405..523 270 43.2 Plus
Dpse\GA26117-PA 423 GA26117-PA 277..414 296..462 226 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15938-PA 643 GM15938-PA 58..643 6..592 2788 97.8 Plus
Dsec\GM24571-PA 575 GM24571-PA 232..479 275..521 414 34.5 Plus
Dsec\GM10968-PA 929 GM10968-PA 389..627 303..543 398 35.7 Plus
Dsec\GM10968-PA 929 GM10968-PA 330..561 300..526 387 34.3 Plus
Dsec\GM10968-PA 929 GM10968-PA 277..494 303..523 387 34.7 Plus
Dsec\GM25548-PA 983 GM25548-PA 641..830 330..523 382 36.6 Plus
Dsec\GM12283-PA 869 GM12283-PA 299..491 330..523 381 35.7 Plus
Dsec\GM24571-PA 575 GM24571-PA 307..548 290..528 379 35.4 Plus
Dsec\GM10968-PA 929 GM10968-PA 470..694 300..522 369 36.5 Plus
Dsec\GM25548-PA 983 GM25548-PA 635..838 288..501 353 34.4 Plus
Dsec\GM24571-PA 575 GM24571-PA 234..424 332..522 339 34.7 Plus
Dsec\GM24571-PA 575 GM24571-PA 289..510 300..522 338 32.7 Plus
Dsec\GM24571-PA 575 GM24571-PA 333..572 288..495 315 31 Plus
Dsec\GM10968-PA 929 GM10968-PA 223..418 332..527 291 33.7 Plus
Dsec\GM10968-PA 929 GM10968-PA 498..695 300..465 212 30.8 Plus
Dsec\GM24571-PA 575 GM24571-PA 432..575 303..442 175 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23994-PA 592 GD23994-PA 7..592 6..592 2753 97.4 Plus
Dsim\GD12643-PA 575 GD12643-PA 232..478 275..520 413 34.7 Plus
Dsim\GD22157-PA 782 GD22157-PA 237..475 303..543 398 35.7 Plus
Dsim\GD22157-PA 782 GD22157-PA 181..409 303..526 385 34.3 Plus
Dsim\GD14561-PA 976 GD14561-PA 634..823 330..523 383 36.6 Plus
Dsim\GD12643-PA 575 GD12643-PA 307..548 290..528 378 35.4 Plus
Dsim\GD21902-PA 477 GD21902-PA 276..476 330..525 377 40.9 Plus
Dsim\GD22157-PA 782 GD22157-PA 318..542 300..522 367 36.5 Plus
Dsim\GD12643-PA 575 GD12643-PA 234..424 332..522 341 34.7 Plus
Dsim\GD12643-PA 575 GD12643-PA 289..510 300..522 335 32.3 Plus
Dsim\GD12643-PA 575 GD12643-PA 333..572 288..495 311 30.6 Plus
Dsim\GD22157-PA 782 GD22157-PA 346..543 300..465 219 30.8 Plus
Dsim\GD12643-PA 575 GD12643-PA 432..575 303..442 175 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11932-PA 596 GJ11932-PA 7..596 6..592 1744 63.2 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 436..695 303..522 415 38.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 410..648 303..543 400 35.7 Plus
Dvir\GJ19494-PA 901 GJ19494-PA 529..820 302..570 391 33.1 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 351..582 300..526 389 34.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 298..515 303..523 389 34.7 Plus
Dvir\GJ10213-PA 615 GJ10213-PA 334..575 302..520 389 32.9 Plus
Dvir\GJ10213-PA 615 GJ10213-PA 358..579 273..494 382 34.8 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 491..715 300..522 369 36.5 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 244..439 332..527 293 33.7 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 86..235 359..521 263 36.2 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 86..294 302..521 257 31.6 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 431..624 383..561 240 32.3 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 536..693 280..438 237 31.9 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 519..716 300..465 220 30.8 Plus
Dvir\GJ17256-PA 695 GJ17256-PA 111..297 299..466 207 29.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18315-PA 593 GK18315-PA 50..593 37..592 1789 68.6 Plus
Dwil\GK14973-PA 1011 GK14973-PA 451..692 300..543 388 35.9 Plus
Dwil\GK14973-PA 1011 GK14973-PA 286..500 303..520 386 35.2 Plus
Dwil\GK14807-PA 1050 GK14807-PA 690..877 332..523 386 37 Plus
Dwil\GK14973-PA 1011 GK14973-PA 398..626 303..526 385 34.8 Plus
Dwil\GK14669-PA 673 GK14669-PA 314..521 287..494 381 33.5 Plus
Dwil\GK14973-PA 1011 GK14973-PA 339..603 300..561 379 32.1 Plus
Dwil\GK14973-PA 1011 GK14973-PA 194..475 267..523 371 29.9 Plus
Dwil\GK14973-PA 1011 GK14973-PA 535..759 300..522 368 37 Plus
Dwil\GK10434-PA 367 GK10434-PA 13..261 256..520 364 33.1 Plus
Dwil\GK14669-PA 673 GK14669-PA 302..525 303..528 360 33.8 Plus
Dwil\GK14807-PA 1050 GK14807-PA 657..874 279..490 353 35 Plus
Dwil\GK14669-PA 673 GK14669-PA 275..435 361..522 293 38.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 232..427 332..527 290 33.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 563..760 300..465 217 30.8 Plus
Dwil\GK14669-PA 673 GK14669-PA 272..405 386..520 212 35.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20880-PA 596 GE20880-PA 7..596 6..592 2541 92.4 Plus
Dyak\GE20043-PA 573 GE20043-PA 222..477 270..520 420 35 Plus
Dyak\GE12687-PA 782 GE12687-PA 237..475 303..543 398 35.7 Plus
Dyak\GE18295-PA 346 GE18295-PA 122..312 326..520 388 39.5 Plus
Dyak\GE12687-PA 782 GE12687-PA 181..409 303..526 385 34.3 Plus
Dyak\GE17974-PA 438 GE17974-PA 180..395 302..520 378 37.3 Plus
Dyak\GE18295-PA 346 GE18295-PA 120..302 354..537 377 38.4 Plus
Dyak\GE20043-PA 573 GE20043-PA 312..547 296..528 375 35.4 Plus
Dyak\GE12687-PA 782 GE12687-PA 318..542 300..522 367 36.5 Plus
Dyak\GE18295-PA 346 GE18295-PA 87..340 264..520 340 30.2 Plus
Dyak\GE20043-PA 573 GE20043-PA 288..509 300..522 335 32.7 Plus
Dyak\GE20043-PA 573 GE20043-PA 332..571 288..495 327 31.4 Plus
Dyak\GE18295-PA 346 GE18295-PA 139..341 288..491 296 33.2 Plus
Dyak\GE20043-PA 573 GE20043-PA 233..395 362..522 264 34.5 Plus
Dyak\GE12687-PA 782 GE12687-PA 346..543 300..465 219 30.8 Plus

RT01137.hyp Sequence

Translation from 5 to 1779

> RT01137.hyp
FKHAMLQRSYDLSPSPARTSPTNGVQNLGAGAQLPPAQVTDFSISKILGK
ERKSAQDTSTNILDLSKSSSNSIRSPQALGGLAIPSTPYASGAYSMLPPD
LVAMANATKFYAQFFPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPN
QQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTRPDCPECLDYYQR
LQTGGYKQTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAASTNISLTT
VTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEI
SYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSV
HRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRV
AFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGK
SFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYV
CPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVPGKQQTGPPP
TLAMAMAQTFQMPPPPGVLTPGSGPSQPPSQQTLLSNLRTF*

RT01137.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-PA 587 CG15269-PA 1..587 5..591 3153 100 Plus
crol-PC 756 CG14938-PC 85..429 204..523 483 30.7 Plus
crol-PH 686 CG14938-PH 85..430 204..523 476 30.4 Plus
crol-PG 878 CG14938-PG 86..466 163..522 476 29.7 Plus
Meics-PB 571 CG8474-PB 262..474 304..519 459 37.8 Plus
crol-PG 878 CG14938-PG 330..551 299..523 439 35.8 Plus
crol-PC 756 CG14938-PC 292..516 299..521 421 36.1 Plus
crol-PG 878 CG14938-PG 414..638 299..521 421 36.1 Plus
crol-PH 686 CG14938-PH 265..471 299..501 371 35.9 Plus
crol-PH 686 CG14938-PH 293..488 299..488 349 36.2 Plus
crol-PC 756 CG14938-PC 320..518 299..465 255 29.9 Plus
crol-PG 878 CG14938-PG 442..640 299..465 255 29.9 Plus