Clone RT02935 Report

Search the DGRC for RT02935

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:29
Well:35
Vector:pCR2.1
Associated Gene/TranscriptEo-RA
Protein status:RT02935.pep: gold
Sequenced Size:1977

Clone Sequence Records

RT02935.complete Sequence

1977 bp assembled on 2009-11-02

GenBank Submission: BT100214.1

> RT02935.complete
ATGGGCGATCAGCGCGTACACAAACCGCGGACAGCGAAGACAAGAACCCT
TCGCGTCAATAGGATATTATTACCGATGTTGCTTCTGTTTTCAGGAGAAA
CTACATCAGTTGTGACCCAATTGTTTTCGGTGGATAGCAGTGGCCTCGGC
ATTTCGCTGATGCAATCGGTGGCCATAGCTCTGAATGCATCCAGCCTCGC
CCTGGCCAACAACACCGCCTGGCCGCTGCAACACGAACCGCCAGAGGATC
GGTTGGAGATCGAGAGCTATGACTATATAGTGGTGGGTGCAGGTAGTGCC
GGATCCATTGTGGCCAGTCGATTGAGTGAGCTGTGCCAGGTGAAGGTCCT
GCTGCTGGAGGAGGGACAATTACCACCGCTGGAATCGGAAATCTTTGGTC
TGACCGGTGCACTGCATCATGACGAGCGGTACATGTTCCTGGAGGAAGCA
GTGCCCAATCCGAAATGCTGCCAGGCAATGGCATCCATGCACGGCTGCGT
TTGGTGGCATGGTCGCATGATGGGCGGTGGTGGTGCCATTAATGGCAATA
TCTTTATACCCGGCAGTCGGGAGAACTTCAGACGCTGGAATTCAACCGGC
TGGGATTGGACGCAGGTCCATAAGACCTACTCTCGCCTGCAACAACGTCT
GAATCCCTCCTATCTTCAACCGAATAAGCTAAACTTGAAGTTGGCCAACC
TAATATACTCCGGTTCCGCAGAACTGGGTGTACCACGGATGAAACAGCCA
TTGATAGCGGGTGCTACGTTCGGTTACACTCATCATGTCCCGGTGACCGT
TAACCAAAGACGAAGGGCCAGCAGCGCACGTTTGTATTTGGCCAATGATC
AAGTGAATAGAAGAGGTAACCTAAAGGTAATACGAGGAGCTCAAGTTCAG
CGGGTACTACTAAATGCGGCTGGATCCCGAGCAACTGGAGTGATTTATAC
CCTAAATGGTGTGGAACACACGGCGAAAACGTTAGGCGAAGTCATCCTAA
GCGCAGGAACCCTCAATTCCGCCAAGTTGCTTCTGCTTTCGGGCATCGGG
CCGCGGGAGGAGCTACAAAGATGGAATATAACTACGCACCAGGACCTTCC
AGTGGGTCGAAATCTACAAGATCATGGAATGATGCCATTGTTTCTGCTCT
TCGGTTCGAATTGTGCCGTCAACAGTACACGGGATCCCACAGAAAATCCC
TATGCTCCTGTATCTATCACACAGTATCTACTGGATAATCAGAAGGGTCC
TTTGGCCAGTGGCTTCTACATGATGGGCTACATCAATTCCAGTTCGCCGA
GCAGCAGTCGTGGTGAACCCGATCTGCATGTGGTGGCCCACACTCTTTTG
CCCAAAGGAAGTACCGGAAGCTTTGGCTATTTGGGCTTTCGGCCAGAGTT
GATTCAGGCTCAGCAGGATATCTTGCAGAAAGGAGATCTACTGCAAATAA
TGGGCTCACTGTTGCGTCCCCTTTCACATGGCAAAGTGAGTCTATCGAGT
AAAAATTCCGCTGATCAGGCAAAAATCGAAAACCACTATGGCGAGGCTGT
AGAGGATCAGCAGACGCTACTTCGCTATGTGCGATATATTCAAAAGTTGA
GCAAAACCCGACCTTTTCGTCGATGTGGTCTACGACTTTGGAAGCCGCCC
CTCCACGAATGCGATACATTAGCTGCCGATTCCGATGACTACTGGTTGTG
TTACATCCGATATTTCTATGTGGGTGCCTGGCATTCCGTGGGCACTTGTC
GCATGGCTCCAAGAAAGGGAGTGGATTCCCAGGAGAATGGAGGCGTGGTG
GACGAAAGATTGAGGGTTCATGGGGTCAAGGGTCTTCGTGTGGTGGATGC
CAGCATTATGCCGGAATTGCCAGCGGGCAATACGAATGGACCCGCCATGA
TGATTGGTGAAAAAGGGGCACAAATGATTCTCGACGATCGGGAGGCGAAT
AATGAGGTGATTCAGGAATGCTGACAC

RT02935.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-RA 1974 Eo-RA 1..1974 1..1974 9870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14806987..14808960 1974..1 9615 99.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-RA 1974 CG9504-PA 1..1974 1..1974 9870 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-RA 2045 CG9504-RA 57..2030 1..1974 9870 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-PA 657 CG9504-PA 1..657 1..1971 3058 100 Plus
CG9509-PB 646 CG9509-PB 67..624 262..1938 585 34.9 Plus
CG9509-PA 646 CG9509-PA 67..624 262..1938 585 34.9 Plus
CG6142-PA 616 CG6142-PA 34..605 226..1935 578 32.2 Plus
CG45065-PA 613 CG45065-PA 44..603 268..1938 571 33.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14916771..14918744 1974..1 9870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14924869..14926842 1974..1 9870 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:09:32 has no hits.

RT02935.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:12:53 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14806985..14808960 1..1977 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-02 12:01:29 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:16:01 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:58:27 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:53 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-02 12:01:27 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:16:01 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 1..1974 1..1974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:58:27 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 57..2032 1..1977 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:53 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
Eo-RA 57..2032 1..1977 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:53 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
X 14916769..14918744 1..1977 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:58:27 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14810802..14812777 1..1977 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:53 Download gff for RT02935.complete
Subject Subject Range Query Range Percent Splice Strand
X 14924867..14926842 1..1977 99   Minus

RT02935.pep Sequence

Translation from 0 to 1973

> RT02935.pep
MGDQRVHKPRTAKTRTLRVNRILLPMLLLFSGETTSVVTQLFSVDSSGLG
ISLMQSVAIALNASSLALANNTAWPLQHEPPEDRLEIESYDYIVVGAGSA
GSIVASRLSELCQVKVLLLEEGQLPPLESEIFGLTGALHHDERYMFLEEA
VPNPKCCQAMASMHGCVWWHGRMMGGGGAINGNIFIPGSRENFRRWNSTG
WDWTQVHKTYSRLQQRLNPSYLQPNKLNLKLANLIYSGSAELGVPRMKQP
LIAGATFGYTHHVPVTVNQRRRASSARLYLANDQVNRRGNLKVIRGAQVQ
RVLLNAAGSRATGVIYTLNGVEHTAKTLGEVILSAGTLNSAKLLLLSGIG
PREELQRWNITTHQDLPVGRNLQDHGMMPLFLLFGSNCAVNSTRDPTENP
YAPVSITQYLLDNQKGPLASGFYMMGYINSSSPSSSRGEPDLHVVAHTLL
PKGSTGSFGYLGFRPELIQAQQDILQKGDLLQIMGSLLRPLSHGKVSLSS
KNSADQAKIENHYGEAVEDQQTLLRYVRYIQKLSKTRPFRRCGLRLWKPP
LHECDTLAADSDDYWLCYIRYFYVGAWHSVGTCRMAPRKGVDSQENGGVV
DERLRVHGVKGLRVVDASIMPELPAGNTNGPAMMIGEKGAQMILDDREAN
NEVIQEC*

RT02935.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19423-PA 628 GF19423-PA 27..627 42..656 2160 65.5 Plus
Dana\GF19426-PA 639 GF19426-PA 9..613 28..646 783 33.9 Plus
Dana\GF19427-PA 623 GF19427-PA 56..614 88..646 702 32.4 Plus
Dana\GF16762-PA 616 GF16762-PA 39..603 81..643 690 31.7 Plus
Dana\GF19431-PA 612 GF19431-PA 26..603 77..646 689 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19430-PA 657 GG19430-PA 1..657 1..657 3113 90.3 Plus
Dere\GG19433-PA 648 GG19433-PA 33..628 48..648 764 33.6 Plus
Dere\GG19438-PA 699 GG19438-PA 5..622 28..652 705 31.2 Plus
Dere\GG11465-PA 616 GG11465-PA 34..605 76..645 702 31.7 Plus
Dere\GG19437-PA 867 GG19437-PA 284..857 81..646 694 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12758-PA 658 GH12758-PA 41..641 46..650 1776 57.8 Plus
Dgri\GH11960-PA 681 GH11960-PA 5..622 28..652 715 31 Plus
Dgri\GH11959-PA 623 GH11959-PA 26..603 77..646 698 33.2 Plus
Dgri\GH19466-PA 615 GH19466-PA 38..602 81..643 692 31.9 Plus
Dgri\GH11956-PA 624 GH11956-PA 56..614 88..646 684 32.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-PA 657 CG9504-PA 1..657 1..657 3436 100 Plus
CG9509-PB 646 CG9509-PB 31..624 48..646 749 33.8 Plus
CG9509-PA 646 CG9509-PA 31..624 48..646 749 33.8 Plus
CG6142-PA 616 CG6142-PA 34..605 76..645 695 32.2 Plus
CG9518-PC 703 CG9518-PC 9..622 35..652 695 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15204-PA 668 GI15204-PA 33..631 46..647 1727 57.3 Plus
Dmoj\GI15376-PA 640 GI15376-PA 25..626 48..646 752 33.3 Plus
Dmoj\GI15380-PA 613 GI15380-PA 30..603 81..646 700 33.6 Plus
Dmoj\GI15377-PA 625 GI15377-PA 12..614 46..646 696 31.6 Plus
Dmoj\GI15381-PA 681 GI15381-PA 5..622 28..652 691 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27079-PA 657 GL27079-PA 1..656 1..654 2132 63.8 Plus
Dper\GL21830-PA 614 GL21830-PA 41..605 81..643 671 31.2 Plus
Dper\GL27088-PA 674 GL27088-PA 51..611 88..643 668 32.4 Plus
Dper\GL12187-PA 612 GL12187-PA 65..604 90..643 591 30.9 Plus
Dper\GL27095-PA 629 GL27095-PA 58..627 86..646 585 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21839-PA 657 GA21839-PA 1..656 1..654 2146 62.8 Plus
Dpse\GA21844-PA 642 GA21844-PA 41..620 60..646 715 34.1 Plus
Dpse\GA21849-PA 691 GA21849-PA 5..622 28..652 712 31 Plus
Dpse\GA22681-PA 623 GA22681-PA 26..603 77..646 687 32.5 Plus
Dpse\GA21847-PA 712 GA21847-PA 89..649 88..643 673 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12017-PA 658 GM12017-PA 1..658 1..657 3158 93.2 Plus
Dsec\GM12020-PA 648 GM12020-PA 69..628 88..648 777 35 Plus
Dsec\GM12021-PA 623 GM12021-PA 37..614 77..646 686 32 Plus
Dsec\GM12023-PA 726 GM12023-PA 94..653 89..643 666 32.8 Plus
Dsec\GM12016-PA 626 GM12016-PA 57..616 87..643 618 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22251-PA 1010 GD22251-PA 386..1010 33..657 3098 94.9 Plus
Dsim\GD15828-PA 845 GD15828-PA 266..825 88..648 783 35.1 Plus
Dsim\GD21272-PA 616 GD21272-PA 34..605 76..645 707 32 Plus
Dsim\GD15832-PA 864 GD15832-PA 281..854 81..646 702 33.7 Plus
Dsim\GD15829-PA 623 GD15829-PA 37..614 77..646 684 32 Plus
Dsim\GD22251-PA 1010 GD22251-PA 132..383 313..565 245 31 Plus
Dsim\GD15828-PA 845 GD15828-PA 57..189 87..218 165 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16614-PA 620 GJ16614-PA 33..595 74..647 1543 53.5 Plus
Dvir\GJ16799-PA 642 GJ16799-PA 24..625 47..646 791 34.8 Plus
Dvir\GJ16802-PA 862 GJ16802-PA 254..853 55..646 724 33.9 Plus
Dvir\GJ16803-PA 666 GJ16803-PA 5..622 28..652 710 31.3 Plus
Dvir\GJ16800-PA 625 GJ16800-PA 12..614 46..646 682 31.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19737-PA 637 GK19737-PA 29..635 39..648 2024 61.2 Plus
Dwil\GK19740-PA 640 GK19740-PA 1..623 23..646 740 32.8 Plus
Dwil\GK19743-PA 885 GK19743-PA 267..841 81..646 715 34.5 Plus
Dwil\GK19744-PA 658 GK19744-PA 5..622 28..652 692 30.6 Plus
Dwil\GK19741-PA 625 GK19741-PA 34..616 68..646 678 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16082-PA 661 GE16082-PA 1..661 1..657 3058 88.2 Plus
Dyak\GE16086-PA 650 GE16086-PA 71..633 88..651 765 34.9 Plus
Dyak\GE23657-PA 616 GE23657-PA 34..605 76..645 713 32.2 Plus
Dyak\GE16091-PA 706 GE16091-PA 5..622 28..652 713 31.2 Plus
Dyak\GE16087-PA 623 GE16087-PA 37..614 77..646 685 31.9 Plus

RT02935.hyp Sequence

Translation from 1 to 1973

> RT02935.hyp
MGDQRVHKPRTAKTRTLRVNRILLPMLLLFSGETTSVVTQLFSVDSSGLG
ISLMQSVAIALNASSLALANNTAWPLQHEPPEDRLEIESYDYIVVGAGSA
GSIVASRLSELCQVKVLLLEEGQLPPLESEIFGLTGALHHDERYMFLEEA
VPNPKCCQAMASMHGCVWWHGRMMGGGGAINGNIFIPGSRENFRRWNSTG
WDWTQVHKTYSRLQQRLNPSYLQPNKLNLKLANLIYSGSAELGVPRMKQP
LIAGATFGYTHHVPVTVNQRRRASSARLYLANDQVNRRGNLKVIRGAQVQ
RVLLNAAGSRATGVIYTLNGVEHTAKTLGEVILSAGTLNSAKLLLLSGIG
PREELQRWNITTHQDLPVGRNLQDHGMMPLFLLFGSNCAVNSTRDPTENP
YAPVSITQYLLDNQKGPLASGFYMMGYINSSSPSSSRGEPDLHVVAHTLL
PKGSTGSFGYLGFRPELIQAQQDILQKGDLLQIMGSLLRPLSHGKVSLSS
KNSADQAKIENHYGEAVEDQQTLLRYVRYIQKLSKTRPFRRCGLRLWKPP
LHECDTLAADSDDYWLCYIRYFYVGAWHSVGTCRMAPRKGVDSQENGGVV
DERLRVHGVKGLRVVDASIMPELPAGNTNGPAMMIGEKGAQMILDDREAN
NEVIQEC*

RT02935.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Eo-PA 657 CG9504-PA 1..657 1..657 3436 100 Plus
CG9509-PB 646 CG9509-PB 31..624 48..646 749 33.8 Plus
CG9509-PA 646 CG9509-PA 31..624 48..646 749 33.8 Plus
CG6142-PA 616 CG6142-PA 34..605 76..645 695 32.2 Plus
CG9518-PC 703 CG9518-PC 9..622 35..652 695 30.7 Plus