Clone RT03105 Report

Search the DGRC for RT03105

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:31
Well:5
Vector:pCR2.1
Associated Gene/TranscriptGr68a-RA
Protein status:RT03105.pep: gold
Sequenced Size:1197

Clone Sequence Records

RT03105.complete Sequence

1197 bp assembled on 2010-02-26

GenBank Submission: BT100081.3

> RT03105.complete
ATGAAGATCTACCAGGATATATATCCTATATCCAAGCCCTCGCAGATCTT
TGCTATATTACCATTCTATAGTGGAGACGTCGATGATGGCTTTCGCTTTG
GAGGATTGGGTCGCTGGTACGGACGACTGGTGGCCCTGATTATACTAATC
GGATCACTGACATTGGGGGAAGATGTGCTCTTCGCCTCCAAGGAGTACAG
ATTGGTGGCCAGTGCCCAAGGTGATACCGAGGAGATCAACAGGACCATCG
AGACGCTTCTGTGTATCATCAGCTATACCATGGTGGTATTATCGAGTGTG
CAGAATGCATCCAGACACTTTCGCACTCTTCACGATATTGCCAAAATCGA
TGAGTATCTGCTGGCCAATGGATTCCGGGAAACCTACAGTTGTCGCAATC
TGACCATTCTGGTCACCTCTGCAGCAGGCGGTGTCCTCGCTGTGGCCTTC
TACTATATTCACTATCGAAGTGGCATTGGTGCCAAAAGGCAAATCATCCT
GCTTCTGATCTACTTCCTCCAACTGCTGTACTCCACTCTCCTGGCCTTAT
ATCTAAGGACACTCATGATGAATTTGGCACAGAGAATTGGATTTCTTAAC
CAGAAACTGGATACGTTTAATCTTCAGGATTGTGGCCACATGGAAAACTG
GCGTGAGTTGAGCAACCTCATAGAGGTCCTTTGCAAATTCCGCTACATCA
CCGAGAATATTAACTGCGTGGCCGGAGTTTCATTGCTATTCTACTTTGGC
TTCTCCTTCTACACGGTCACAAATCAGAGTTACTTGGCCTTTGCCACATT
GACAGCCGGCTCGTTGAGTTCCAAAACAGAAGTGGCTGATACCATAGGAC
TATCATGTATCTGGGTTTTGGCTGAAACTATCACAATGATTGTGATTTGC
AGCGCATGTGACGGCCTGGCATCCGAGGTGAATGGCACGGCACAGATCCT
GGCGAGAATTTACGGCAAGAGCAAGCAGTTCCAGAACCTCATCGACAAGT
TCCTAACGAAGAGCATCAAACAGGATCTTCAGTTCACCGCCTACGGATTC
TTTTCCATAGACAACTCAACACTCTTCAAGATCTTCTCGGCTGTTACTAC
CTATCTGGTGATTCTCATTCAATTCAAGCAGTTGGAGGACTCCAAGGTGG
AAGACATTAGTCAGGCATAACACTTCTATAGTGTCACCTAAATTCGC

RT03105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-RA 1170 Gr68a-RA 1..1170 1..1170 5850 100 Plus
Gr32a-RA 1386 Gr32a-RA 1192..1352 982..1142 265 77.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11742183..11743352 1..1170 5700 99.1 Plus
chr2L 23010047 chr2L 11114257..11114340 997..1080 195 82.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-RA 1170 CG7303-PA 1..1170 1..1170 5850 100 Plus
Gr32a-RA 1386 CG14916-PA 1192..1352 982..1142 265 77.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:42:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-RA 1170 CG7303-RA 1..1170 1..1170 5850 100 Plus
Gr32a-RA 1623 CG14916-RA 1361..1521 982..1142 265 77.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-PA 389 CG7303-PA 1..389 1..1167 1831 100 Plus
Gr32a-PA 461 CG14916-PA 303..455 685..1155 406 55.1 Plus
Gr39a-PD 381 CG31622-PD 218..374 682..1143 213 31 Plus
Gr39a-PA 371 CG31622-PA 279..364 886..1143 208 44.2 Plus
Gr39a-PC 381 CG31622-PC 224..374 655..1143 199 31.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11751305..11752474 1..1170 5850 100 Plus
2L 23513712 2L 11115502..11115585 997..1080 195 82.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11744405..11745574 1..1170 5850 100 Plus
2L 23513712 2L 11115502..11115585 997..1080 195 82.1 Plus
Blast to na_te.dros performed on 2014-11-27 11:41:18 has no hits.

RT03105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:30:37 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11742183..11743352 1..1170 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-26 18:15:37 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:20 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:40 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:37 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-26 18:15:34 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:19 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:40 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:37 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
Gr68a-RA 1..1170 1..1170 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:30:37 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11751305..11752474 1..1170 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:40 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11744405..11745574 1..1170 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:49 Download gff for RT03105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11744405..11745574 1..1170 100   Plus

RT03105.pep Sequence

Translation from 0 to 1169

> RT03105.pep
MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILI
GSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSV
QNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAF
YYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLN
QKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFG
FSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVIC
SACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGF
FSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDISQA*

RT03105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25287-PA 395 GF25287-PA 1..392 1..387 1435 70.4 Plus
Dana\GF15642-PA 457 GF15642-PA 128..451 75..385 465 39.3 Plus
Dana\GF14323-PA 671 GF14323-PA 542..665 264..381 206 37.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15527-PA 389 GG15527-PA 1..389 1..389 1799 91.8 Plus
Dere\GG23707-PA 461 GG23707-PA 124..458 75..388 454 37.4 Plus
Dere\GG21294-PA 381 GG21294-PA 224..374 219..381 192 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10309-PA 769 GH10309-PA 3..314 1..312 938 58.7 Plus
Dgri\GH10309-PA 769 GH10309-PA 445..763 75..385 463 38.5 Plus
Dgri\GH13849-PA 670 GH13849-PA 500..663 209..381 216 32.4 Plus
Dgri\GH24883-PA 416 GH24883-PA 174..410 165..382 159 25.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-PA 389 CG7303-PA 1..389 1..389 1966 100 Plus
Gr32a-PA 461 CG14916-PA 124..455 75..385 471 38.3 Plus
Gr39a-PA 371 CG31622-PA 103..364 111..381 225 26.5 Plus
Gr39a-PD 381 CG31622-PD 147..374 150..381 220 26.7 Plus
Gr39a-PC 381 CG31622-PC 224..374 219..381 199 31.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17070-PA 765 GI17070-PA 1..310 1..310 875 56.1 Plus
Dmoj\GI17070-PA 765 GI17070-PA 443..761 75..385 472 39.8 Plus
Dmoj\GI12187-PA 668 GI12187-PA 498..661 209..381 238 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20715-PA 224 GL20715-PA 1..207 168..369 715 70.5 Plus
Dper\GL19543-PA 449 GL19543-PA 119..441 75..385 474 39.2 Plus
Dper\GL26657-PA 672 GL26657-PA 542..665 264..381 204 35.5 Plus
Dper\GL14254-PA 400 GL14254-PA 198..392 192..381 162 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Gr68a-PA 393 GA20248-PA 1..391 1..386 1313 67.5 Plus
Dpse\Gr32a-PA 449 GA13351-PA 119..441 75..385 474 39.2 Plus
Dpse\Gr39a-PA 758 GA16340-PA 632..751 260..381 215 36.9 Plus
Dpse\Gr2a-PA 336 GA14976-PA 189..328 242..381 155 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25296-PA 394 GM25296-PA 1..388 1..388 1886 96.1 Plus
Dsec\GM18907-PA 461 GM18907-PA 124..459 75..389 460 36.9 Plus
Dsec\GM23407-PA 381 GM23407-PA 224..374 219..381 196 31.9 Plus
Dsec\GM19140-PA 410 GM19140-PA 258..402 237..381 150 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14327-PA 394 GD14327-PA 1..388 1..388 1883 96.1 Plus
Dsim\GD23763-PA 461 GD23763-PA 124..455 75..385 457 37 Plus
Dsim\GD24315-PA 674 GD24315-PA 595..667 309..381 195 47.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10564-PA 313 GJ10564-PA 1..313 1..313 854 58.4 Plus
Dvir\GJ10575-PA 442 GJ10575-PA 118..436 75..385 489 38.4 Plus
Dvir\GJ17846-PA 669 GJ17846-PA 464..662 172..381 218 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10496-PA 403 GK10496-PA 1..394 1..385 1249 63.5 Plus
Dwil\GK18365-PA 457 GK18365-PA 131..450 75..386 479 38.9 Plus
Dwil\GK18735-PA 683 GK18735-PA 515..665 219..381 199 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21845-PA 385 GE21845-PA 1..385 1..389 1811 90 Plus
Dyak\GE18514-PA 457 GE18514-PA 124..455 75..385 440 36.8 Plus
Dyak\GE12911-PA 674 GE12911-PA 590..667 304..381 203 48.7 Plus

RT03105.hyp Sequence

Translation from 1 to 1169

> RT03105.hyp
MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILI
GSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSV
QNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAF
YYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLN
QKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFG
FSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVIC
SACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGF
FSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDISQA*

RT03105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Gr68a-PA 389 CG7303-PA 1..389 1..389 1966 100 Plus
Gr32a-PA 461 CG14916-PA 124..455 75..385 471 38.3 Plus
Gr39a-PA 371 CG31622-PA 103..364 111..381 225 26.5 Plus
Gr39a-PD 381 CG31622-PD 147..374 150..381 220 26.7 Plus
Gr39a-PC 381 CG31622-PC 224..374 219..381 199 31.3 Plus