Clone SD03414 Report

Search the DGRC for SD03414

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:34
Well:14
Vector:pOT2
Associated Gene/TranscriptCG13384-RE
Protein status:SD03414.pep: gold
Sequenced Size:2277

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13384-RD 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

SD03414.complete Sequence

2277 bp assembled on 2011-01-07

GenBank Submission: BT125875.1

> SD03414.complete
CAACAGTTTTAGTTGCAACATTATCATTTTTCCAACTGCCCAAAAGACGC
GTTCCTACAACTCAACCATCTCCAGTTGAGATACATCTAATTTCCGATAT
AGTCAGTATTCCCGAGGGAGCGCCGCGCAAGAAAAAGATGACGGAACGAC
AGCCGTTGCTCCTCCAGAGCGATGCCTCTGACTACGAGGGCAGTCGAGGA
TCGGCAGCACGACCCGTGCGCAGCTCTCCGCCGGACAACACTCTCGTCAA
CGTGCACAGCGAGGACAGCTTAGCAGCAGCCTCTGGATCGGGAGATGATG
AAATTGGATCGACGGATAAGTCCTATAACCCCACCCATCATCGCGACCTG
GAGCATCCGACGTCCAACTTCGATACCCTGGTTCATCTGCTGAAGGGCAA
CATTGGTACGGGCATTCTGGCAATGCCGGATGCCTTTAAGAACGCCGGAC
TTTATGTGGGACTCTTTGGCACAATGATCATGGGAGCCATCTGCACCCAC
TGCATGCACATGCTGGTCAACTGCTCCCACGAGCTGTGCCGGAGATTCCA
GCAGCCATCGTTAGATTTCTCGGAGGTGGCATACTGCAGTTTTGAGTCGG
GACCTTTGGGACTAAGACGATACTCCATGTTGGCTCGACGAATTGTTACC
ACGTTCTTGTTTATCACGCAAATCGGTTTCTGCTGCGTCTACTTCCTCTT
TGTGGCGTTGAATATCAAGGACGTTATGGATCACTACTACAAGATGCCTG
TGCAGATTTACCTGCTTATAATGCTTGGACCCATGATCCTGTTGAATCTG
GTGCGGAATCTGAAGTATTTGACACCCGTTTCGCTGGTTGCCGCCCTGCT
CACAGTTGCCGGACTGGCCATTACATTCTCGTACATGCTGGTGGATCTGC
CGGATGTGCACACGGTCAAGCCGGTGGCCACTTGGGCGACGTTGCCTCTA
TATTTTGGAACCGCCATCTACGCGTTCGAGGGAATTGGTGTTGTCCTGCC
CTTGGAGAACAATATGCGCACACCCGAGGACTTTGGCGGCACCACAGGTG
TCCTCAACACGGGCATGGTGATCGTGGCCTGCTTGTACACAGCTGTCGGG
TTCTTCGGCTACCTGAAGTACGGCGAACACGTGGAGGGCAGCATTACCCT
AAATCTGCCGCAAGGCGACACACTTTCCCAGTTGGTGCGGATTTCAATGG
CGGTGGCCATCTTCCTCTCGTATACGCTTCAGTTTTATGTGCCTGTGAAC
ATCGTGGAACCCTTTGTGCGAAGTCATTTCGATACAACGAGGGCCAAGGA
TTTGTCAGCAACTGTGCTGCGAGTTGTTCTGGTCACTTTTACCTTCCTGC
TGGCCACCTGTATTCCCAATCTAGGCTCCATTATCTCGCTGGTAGGAGCC
GTCAGCAGCTCAGCTTTGGCCCTAATTGCACCACCCATAATTGAAGTTAT
TACATTTTACAACGTTGGCTATGGACGCTTCAATTGGATGCTATGGAAGG
ACGTTTTAATCCTGATCTTTGGACTCTGTGGCTTTGTGTTTGGCACCTGG
GCCAGCTTAGCTCAAATCCTGAACGACAGAACCCACTGAGTTTAATCGAA
ATAAGCGAATCGAAAACAGAACCTGGCTAGTTCTGCCTACAAATGTGTGC
GAATTTATGACGAAGGCTTTATGTAGTTACACTCAGACTACGAATATGTT
TACCATTAGTTGTTTACCATTTCCCAACTGGTATCGGTCCAGTCCAGTGG
CGGTGCTTTAGTGTGATTAATTTATATTTATGGCAAATTAGTTGCATTTT
TTTTTGTTGTTAGCAGCCAGCTGCAATCGTACCAGACAATAACTAGCATT
TTAAGTAGAAAGTTTTTCAACATTTGTTCAGTTTGTCAGTTGGAGATTAT
TTCTGTGTTAACTCGATGACCGCACAATGCCAAACGTGATTTTACGTAGT
ATTCTTAACTAAATTATTATTTAGCTTTTACTATGTAGTCTAGGTCGGGG
CAGATCATTCCATAGCAACTGCTAAGAATTTCCCAAAAACCGAAATTAGC
TAATGTTATCTGCATACTTTTATCGTTCGATTATTTGTAATTATACAACT
ATAAATACATATATATGTATACCCCTAGCCGTACTGGTCCCGAAATGGGA
CCTTCGATAAAGTTTTGTAAATACATCAATTCGGTGTATCAACAAATGTT
CTTTAATAGTTCAATCGGTAACAAAGACAATAATTAATATAATGTTTATA
AAAATCAAAAAAAAAAAAAAAAAAAAA

SD03414.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8385391..8386289 273..1171 4465 99.8 Plus
chr2L 23010047 chr2L 8386802..8387712 1345..2256 4465 99.6 Plus
chr2L 23010047 chr2L 8386570..8386742 1172..1344 850 99.4 Plus
chr2L 23010047 chr2L 8385128..8385296 108..276 845 100 Plus
chr2L 23010047 chr2L 8383905..8384008 4..107 490 98.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-RC 1515 CG13384-PC 37..1515 108..1589 7270 99.5 Plus
CG13384-RI 1452 CG13384-PI 1..1452 138..1589 7200 99.7 Plus
CG13384-RH 1452 CG13384-PH 1..1452 138..1589 7200 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-RI 2510 CG13384-RI 253..2508 1..2256 11160 99.6 Plus
CG13384-RH 2560 CG13384-RH 303..2558 1..2256 11160 99.6 Plus
CG13384-RF 2534 CG13384-RF 277..2532 1..2256 11160 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-PC 504 CG13384-PC 7..504 90..1586 2224 98.6 Plus
CG13384-PI 483 CG13384-PI 1..483 138..1586 2183 100 Plus
CG13384-PH 483 CG13384-PH 1..483 138..1586 2183 100 Plus
CG13384-PF 483 CG13384-PF 1..483 138..1586 2183 100 Plus
CG13384-PE 483 CG13384-PE 1..483 138..1586 2183 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8387891..8388803 1345..2257 4520 99.7 Plus
2L 23513712 2L 8386480..8387378 273..1171 4465 99.8 Plus
2L 23513712 2L 8387659..8387831 1172..1344 850 99.4 Plus
2L 23513712 2L 8386217..8386385 108..276 845 100 Plus
2L 23513712 2L 8384994..8385097 4..107 490 98.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8387891..8388803 1345..2257 4520 99.6 Plus
2L 23513712 2L 8386480..8387378 273..1171 4465 99.7 Plus
2L 23513712 2L 8387659..8387831 1172..1344 850 99.4 Plus
2L 23513712 2L 8386217..8386385 108..276 845 100 Plus
2L 23513712 2L 8384994..8385097 4..107 490 98 Plus
Blast to na_te.dros performed 2014-11-27 16:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 4216..4249 2209..2176 125 85.3 Minus
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 420..465 2127..2082 122 73.9 Minus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2497..2547 2115..2065 120 70.6 Minus

SD03414.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:58:12 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8386802..8387712 1345..2256 99   Plus
chr2L 8386570..8386742 1172..1344 99 -> Plus
chr2L 8385395..8386289 277..1171 99 -> Plus
chr2L 8385128..8385296 108..276 100 -> Plus
chr2L 8383902..8384008 1..107 95 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-07 15:05:57 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RC 34..1515 104..1589 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:38:58 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RC 34..1515 104..1589 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:58:12 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RC 34..1515 104..1589 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:05:56 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RF 253..2508 1..2256 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:38:58 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RF 277..2532 1..2256 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:58:12 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
CG13384-RF 277..2532 1..2256 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:58:12 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8387891..8388802 1345..2256 99   Plus
2L 8387659..8387831 1172..1344 99 -> Plus
2L 8386484..8387378 277..1171 99 -> Plus
2L 8386217..8386385 108..276 100 -> Plus
2L 8384991..8385097 1..107 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:38:58 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8387891..8388802 1345..2256 99   Plus
arm_2L 8387659..8387831 1172..1344 99 -> Plus
arm_2L 8386484..8387378 277..1171 99 -> Plus
arm_2L 8386217..8386385 108..276 100 -> Plus
arm_2L 8384991..8385097 1..107 95 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:19 Download gff for SD03414.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8387891..8388802 1345..2256 99   Plus
2L 8387659..8387831 1172..1344 99 -> Plus
2L 8386484..8387378 277..1171 99 -> Plus
2L 8386217..8386385 108..276 100 -> Plus
2L 8384991..8385097 1..107 95 -> Plus

SD03414.pep Sequence

Translation from 2 to 1588

> SD03414.pep
TVLVATLSFFQLPKRRVPTTQPSPVEIHLISDIVSIPEGAPRKKKMTERQ
PLLLQSDASDYEGSRGSAARPVRSSPPDNTLVNVHSEDSLAAASGSGDDE
IGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGL
YVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESG
PLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYYKMPV
QIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLP
DVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGV
LNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMA
VAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLL
ATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKD
VLILIFGLCGFVFGTWASLAQILNDRTH*

SD03414.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15226-PA 452 GF15226-PA 15..445 38..464 2005 87.5 Plus
Dana\GF23811-PA 644 GF23811-PA 175..635 62..521 1036 45.7 Plus
Dana\GF10626-PA 462 GF10626-PA 22..457 92..523 862 42.7 Plus
Dana\GF11466-PA 502 GF11466-PA 7..496 43..524 826 36.5 Plus
Dana\GF24657-PA 470 GF24657-PA 30..462 82..524 808 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10546-PA 506 GG10546-PA 7..506 30..528 2586 97.8 Plus
Dere\GG13950-PA 616 GG13950-PA 148..607 62..521 1057 45.9 Plus
Dere\GG15470-PA 465 GG15470-PA 6..460 73..523 872 41.8 Plus
Dere\GG22563-PA 477 GG22563-PA 17..471 68..524 846 40.6 Plus
Dere\GG14028-PA 519 GG14028-PA 84..509 98..524 827 41.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10379-PA 509 GH10379-PA 7..509 30..524 2118 81.7 Plus
Dgri\GH23642-PA 396 GH23642-PA 2..396 108..524 1823 82.5 Plus
Dgri\GH16577-PA 591 GH16577-PA 84..577 1..521 1050 42.4 Plus
Dgri\GH14926-PA 472 GH14926-PA 3..467 64..523 857 40.9 Plus
Dgri\GH15148-PA 470 GH15148-PA 34..461 96..524 854 41.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-PC 504 CG13384-PC 7..504 30..528 2546 98.6 Plus
CG13384-PI 483 CG13384-PI 1..483 46..528 2505 100 Plus
CG13384-PH 483 CG13384-PH 1..483 46..528 2505 100 Plus
CG13384-PF 483 CG13384-PF 1..483 46..528 2505 100 Plus
CG13384-PE 483 CG13384-PE 1..483 46..528 2505 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17357-PA 519 GI17357-PA 7..515 30..524 2174 84.1 Plus
Dmoj\GI13867-PA 592 GI13867-PA 124..578 50..521 1044 45.2 Plus
Dmoj\GI14798-PA 452 GI14798-PA 6..444 88..524 847 41.5 Plus
Dmoj\GI12085-PA 470 GI12085-PA 36..461 98..524 838 39.9 Plus
Dmoj\GI21155-PA 482 GI21155-PA 10..482 60..528 834 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25941-PA 508 GL25941-PA 13..508 34..528 2368 89.5 Plus
Dper\GL15745-PA 618 GL15745-PA 144..609 37..521 1028 44.1 Plus
Dper\GL15673-PA 479 GL15673-PA 48..474 101..523 866 44.3 Plus
Dper\GL11031-PA 477 GL11031-PA 34..471 87..524 824 40.4 Plus
Dper\GL17962-PA 435 GL17962-PA 34..430 96..527 769 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25197-PA 508 GA25197-PA 13..508 34..528 2368 89.5 Plus
Dpse\GA19514-PA 507 GA19514-PA 3..498 10..521 1026 42.8 Plus
Dpse\GA20662-PA 479 GA20662-PA 48..474 101..523 866 44.3 Plus
Dpse\GA17443-PA 469 GA17443-PA 34..464 96..527 862 41 Plus
Dpse\GA21321-PA 477 GA21321-PA 34..471 87..524 824 40.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16926-PA 508 GM16926-PA 7..508 30..528 2594 97.6 Plus
Dsec\GM24786-PA 440 GM24786-PA 34..429 62..458 879 45 Plus
Dsec\GM25242-PA 462 GM25242-PA 3..457 73..523 878 41.9 Plus
Dsec\GM20346-PA 474 GM20346-PA 10..468 62..524 845 39.7 Plus
Dsec\GM24863-PA 519 GM24863-PA 84..509 98..524 842 42 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23535-PA 508 GD23535-PA 7..508 30..528 2603 97.6 Plus
Dsim\GD12836-PA 502 GD12836-PA 34..493 62..521 1031 45.3 Plus
Dsim\GD14275-PA 462 GD14275-PA 3..457 73..523 875 41.7 Plus
Dsim\GD25825-PA 474 GD25825-PA 16..468 67..524 848 40.7 Plus
Dsim\GD12915-PA 519 GD12915-PA 84..513 98..528 830 41.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18031-PA 518 GJ18031-PA 7..514 30..524 2213 85 Plus
Dvir\GJ11728-PA 601 GJ11728-PA 118..587 57..521 1048 45.7 Plus
Dvir\GJ13356-PA 471 GJ13356-PA 37..462 98..524 847 39.9 Plus
Dvir\GJ13640-PA 466 GJ13640-PA 33..461 99..523 835 41.5 Plus
Dvir\GJ19463-PA 446 GJ19463-PA 22..438 110..524 813 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18413-PA 501 GK18413-PA 7..500 30..527 2091 80.2 Plus
Dwil\GK18659-PA 501 GK18659-PA 7..500 30..527 2086 80 Plus
Dwil\GK12679-PA 588 GK12679-PA 153..579 94..521 1060 48.5 Plus
Dwil\GK11241-PA 488 GK11241-PA 45..483 92..523 872 43 Plus
Dwil\GK10461-PA 450 GK10461-PA 16..444 96..525 865 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18766-PA 509 GE18766-PA 7..509 30..528 2580 97.2 Plus
Dyak\GE20249-PA 599 GE20249-PA 131..590 62..521 1046 45.7 Plus
Dyak\GE21779-PA 465 GE21779-PA 6..460 73..523 869 41.7 Plus
Dyak\GE13433-PA 477 GE13433-PA 17..471 68..524 848 40.1 Plus
Dyak\GE17642-PA 468 GE17642-PA 11..460 78..524 809 39.2 Plus

SD03414.hyp Sequence

Translation from 2 to 1588

> SD03414.hyp
SVLVSTLSFFQLPKRRVPTTQPSPVEIHLISDTVSIPEGAPRKKKMTERQ
PLLLQSDASDYEGSRGSAARPVRSSPPDNTLVNVHSEDSLAAASGSGDDE
IGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGL
YVGLFGTMIMGAICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESG
PLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIKDVMDHYYKMPV
QIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLP
DVHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGV
LNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMA
VAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLL
ATCIPNLGSIISLVGAVSSSALALIAPPIIEVITFYNVGYGRFNWMLWKD
VLILIFGLCGFVFGTWASLAQILNDRTH*

SD03414.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13384-PC 504 CG13384-PC 7..504 30..528 2543 98.6 Plus
CG13384-PI 483 CG13384-PI 1..483 46..528 2505 100 Plus
CG13384-PH 483 CG13384-PH 1..483 46..528 2505 100 Plus
CG13384-PF 483 CG13384-PF 1..483 46..528 2505 100 Plus
CG13384-PE 483 CG13384-PE 1..483 46..528 2505 100 Plus