Clone SD04091 Report

Search the DGRC for SD04091

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:40
Well:91
Vector:pOT2
Associated Gene/TranscriptMef2-RE
Protein status:SD04091.pep: validated full length
Preliminary Size:2257
Sequenced Size:2309

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1429 2001-10-10 Blastp of sequenced clone
CG1429 2003-01-01 Sim4 clustering to Release 3
Mef2 2008-04-29 Release 5.5 accounting
Mef2 2008-08-15 Release 5.9 accounting
Mef2 2008-12-18 5.12 accounting
CG1429 2011-03-01 Transcript Validation

Clone Sequence Records

SD04091.complete Sequence

2309 bp (2309 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061589

> SD04091.complete
TTTCGTCGTAGGCTCCGATTGGACCGATCTGATCAGACTTTGAATCGATC
GCATTGATTTCGAAACGCAGACTCTTAATCGCGAACTAGCCGAATGCACA
AGATCAGGTCGAAAACACGCTGACAAATTAATTATATACACTAAAAACCT
GCGAAAACGTGCGCTCTTACGTCGGCCGTGTGAGTGCGTGTGTGTGGTGC
GCTCTTCTCTCAACCGCCCCCCACCCCCTTCGCCCACGTTTCGCTCAGCG
CGCAAAAGTAAATTTTAGTGCAAATAAATTGCTTTGCTTATCTCGAAGCG
CGCGCTCGCATGATGAACGCAGCTGTGTGCGTGAGTGTGTTTGTGGGGAG
TGAGTGTGCGAGTGTTGTTAATTAATTTACAAAAGTCACTCCTGTTTGGC
GAACAACAGAGAACAACAATAACACCACAAGAGGCAGCGAGAAGTGCGAA
AACGAAAGAAAAACAACAACAGACCTGCTAACGGCAGTTGCATGTGGGCC
ACTTCGCCCACCCAACCCCCCACCCCATCCCTCGCTGGTGGAAAACGAAA
GTTCTTTTACATGTAACACAGCAAGACTCTCAGAAAGGAGAAGGAGAGAG
CGCAGAGCCCCACGCAGAGCGTGAGCGAAACAGAAGCGAGAGCGCCAATG
CAGGAGAGCGACATTTGGCCTTGAACTTGCGGACGTTACCTGGGGACAAT
TTATACGGAAACACAATTAAATAAAATTATATACACAACTATATACAAGT
AGAACTTGCCGTTTTAACAAGCCGTCCACTTATAAAACAAACAGAAGGGA
TTATATATAGACAACCTATATAAATATGCCCCACGTCTGCCACGCCAGGA
AGAGCCACAGCAATTCGCAGGGCAGCAACTAACGGAGTTTCCCCGCCAGC
TGCCGGAAATCCAGTAGCAAATCCAGCAAACCAGCGACCCAGTCAGCAGG
AATCAGCCAGCCGAGCCGAGCACAAGGACACCACCATCTCCGTTTCCATC
GCAGGAGGATAGGAAATCTGTTGCCATGGGCCGCAAAAAAATTCAAATAT
CACGCATCACCGATGAACGCAATCGGCAGGTGACCTTCAACAAGCGCAAG
TTCGGCGTGATGAAGAAGGCCTACGAGCTGTCCGTGCTCTGCGACTGCGA
GATCGCCCTGATCATCTTCTCGTCGAGCAACAAGCTGTACCAGTACGCCA
GCACCGACATGGATCGCGTCCTGCTCAAGTACACCGAGTACAACGAGCCC
CACGAGTCCCTCACCAACAAGAACATCATCGAGAAGGAGAACAAGAACGG
CGTGATGTCGCCGGACTCGCCCGAAGCCGAAACGGACTACACACTCACTC
CGCGAACGGAGGCCAAGTACAACAAGATCGACGAGGAGTTCCAGAACATG
ATGCAGCGCAACCAGATGGCCATCGGCGGTGCGGGTGCCCCTCGCCAGCT
TCCAAACAGCAGCTACACGCTGCCCGTTTCTGTTCCGGTGCCGGGATCTT
ACGGCGACAACCTGCTGCAGGCCAGTCCACAGATGTCCCACACCAACATC
AGCCCCCGTCCATCGAGTTCGGAGACGGATTCAGGTGGGATGTCCCTGAT
AAGTTAGTACAGTGTCTCGCGCCGGCTGCACACACATTTCTATCTATCTA
TCGTTGGTTCTGTTTTATGTTTTTTTCTGGATTTGTTGCCTTAGTTTCTT
TCTCTCTGATTTGATTTGAACTGAACTGACATGATTGCATGCTTGCTCGA
AACTCTAACTAACTCTAACTCTTTAACCGTGCTTTTGTTTTTTTTTCTGA
TATTTAATTTCTGATTTCCCTAACCCACTCACCGCCATCTAACCAAGTTG
CGTGCGAAGTTCTGTATACCATATACACGTAGATATATATATATATAGTG
ACATATTCACATACAAAACCACATAACGTAGAGTAAACATATTGAAAAGC
CGCATACGTAAACAATAAGTGACCACCATGCTAATGTGGATCAAATAACA
AAAATATCCACTCTGCATTTTGACACCCCCATACTGTATGCCATCTGCGC
AGTATGCATTCTAATAAACAAATTCTTTGACAGCGGCACTTAGCCATTCT
TGTAAACAAATCTTAAAGTCTGCCTGCTCTCTCTGAGGCTTCTCCTCCAC
TTAAGAATCCAAGAGCAATGCTCTCCCAAAAACACTAACATATTCTTTAA
GCAAGCACAGAGGCTTCTCCTCATTTTCACTTTCATTTGATTTTCAGTCT
TAAGCTGAACGTTAATCAATAAACAACACAATCGATACCGAAAAAAAAAA
AAAAAAAAA

SD04091.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2.a 2738 Mef2.a 154..1075 685..1606 4580 99.7 Plus
Mef2.d 3341 Mef2.d 154..1075 685..1606 4580 99.7 Plus
Mef2-RF 6142 Mef2-RF 1047..1945 686..1584 4480 99.8 Plus
Mef2-RF 6142 Mef2-RF 153..840 1..688 3440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5845652..5846336 685..1 3425 100 Minus
chr2R 21145070 chr2R 5806621..5807237 1897..1282 3020 99.7 Minus
chrU 10048995 chrU 9614450..9614854 1886..2290 2010 99.8 Plus
chr3LHet 2555433 chr3LHet 1121634..1122041 1883..2290 2010 99.5 Plus
chrX 22417052 chrX 3653957..3654360 2290..1887 2005 99.8 Minus
chr3L 24539361 chr3L 11261877..11262280 2290..1887 2005 99.8 Minus
chr2R 21145070 chr2R 5614091..5614496 1885..2290 2000 99.5 Plus
chr2R 21145070 chr2R 5809093..5809491 1083..685 1995 100 Minus
chr3L 24539361 chr3L 10059004..10059408 2290..1886 1995 99.5 Minus
chr3R 27901430 chr3R 834424..834831 2290..1883 1995 99.3 Minus
chr2R 21145070 chr2R 6835673..6836073 1890..2290 1990 99.8 Plus
chr3L 24539361 chr3L 1505546..1505952 1884..2290 1990 99.3 Plus
chrU 10048995 chrU 1306658..1307060 2290..1888 1985 99.5 Minus
chrU 10048995 chrU 8121578..8121977 2290..1891 1985 99.8 Minus
chrX 22417052 chrX 14194713..14195117 1886..2290 1980 99.3 Plus
chr2RHet 3288813 chr2RHet 853694..854092 1892..2290 1980 99.7 Plus
chr2R 21145070 chr2R 1796593..1796991 2290..1892 1965 99.5 Minus
chr2R 21145070 chr2R 6842662..6843055 1897..2290 1955 99.7 Plus
chrU 10048995 chrU 3694162..3694555 2290..1897 1955 99.7 Minus
chrX 22417052 chrX 3646971..3647364 2290..1897 1955 99.7 Minus
chr3L 24539361 chr3L 11255494..11255887 2290..1897 1955 99.7 Minus
chr2RHet 3288813 chr2RHet 860687..861080 1897..2290 1955 99.7 Plus
chr2R 21145070 chr2R 1789603..1789996 2290..1897 1940 99.5 Minus
chr2R 21145070 chr2R 5621085..5621478 1897..2290 1940 99.5 Plus
chr3LHet 2555433 chr3LHet 1127461..1127854 1897..2290 1940 99.5 Plus
chr3L 24539361 chr3L 1512587..1512980 1897..2290 1940 99.5 Plus
chr3L 24539361 chr3L 10051994..10052387 2290..1897 1940 99.5 Minus
chr3R 27901430 chr3R 6629736..6630134 1892..2290 1935 99 Plus
chrU 10048995 chrU 6399663..6400056 1897..2290 1925 99.2 Plus
chrX 22417052 chrX 14200366..14200759 1897..2290 1925 99.2 Plus
chr3R 27901430 chr3R 828184..828577 2290..1897 1925 99.2 Minus
chr3R 27901430 chr3R 6636704..6637097 1897..2290 1910 99 Plus
chrU 10048995 chrU 7081617..7082009 1897..2290 1875 99 Plus
chrU 10048995 chrU 7904364..7904705 2233..1892 1710 100 Minus
chr3RHet 2517486 chr3RHet 160643..161070 2290..1883 1620 93.3 Minus
chrU 10048995 chrU 246466..246845 2258..1885 1610 95.8 Minus
chrU 10048995 chrU 8799004..8799377 1897..2290 1605 94.4 Plus
chrU 10048995 chrU 8099531..8099904 2258..1891 1595 96 Minus
chr3RHet 2517486 chr3RHet 58665..59032 2258..1897 1565 96 Minus
chrU 10048995 chrU 239762..240129 2258..1897 1535 95.4 Minus
chr2RHet 3288813 chr2RHet 1464519..1464932 2290..1897 1535 92.8 Minus
chr3RHet 2517486 chr3RHet 65628..65998 2258..1892 1525 95.5 Minus
chr3RHet 2517486 chr3RHet 153747..154160 2290..1897 1505 92.3 Minus
chrU 10048995 chrU 7093688..7094109 2290..1888 1500 92.3 Minus
chr2RHet 3288813 chr2RHet 1471428..1471856 2290..1883 1500 91.9 Minus
chrU 10048995 chrU 9677897..9678214 1971..2290 1470 98.8 Plus
chrU 10048995 chrU 5624862..5625212 1888..2232 1465 95.5 Plus
chr3LHet 2555433 chr3LHet 2552085..2552435 2232..1888 1465 95.5 Minus
chr2RHet 3288813 chr2RHet 1148937..1149318 1897..2258 1390 92.5 Plus
chr2RHet 3288813 chr2RHet 1155252..1155633 1897..2258 1375 92.2 Plus
chrU 10048995 chrU 7914072..7914459 2258..1890 1335 91.6 Minus
chrU 10048995 chrU 6770145..6770515 1908..2258 1320 92 Plus
chrU 10048995 chrU 7920078..7920454 1905..2258 1250 91.6 Plus
chr3L 24539361 chr3L 23820825..23821147 2181..1883 1170 92.3 Minus
chr2RHet 3288813 chr2RHet 2360257..2360675 2290..1892 1170 86.8 Minus
chr3L 24539361 chr3L 24185942..24186261 1886..2181 1155 92.2 Plus
chr3LHet 2555433 chr3LHet 1664970..1665289 1886..2181 1140 91.9 Plus
chr3L 24539361 chr3L 23068212..23068534 2181..1883 1140 91.6 Minus
chr3L 24539361 chr3L 24206683..24207002 1886..2181 1140 91.9 Plus
chrU 10048995 chrU 3899847..3900164 2181..1888 1115 91.5 Minus
chrU 10048995 chrU 9162502..9162816 2181..1891 1115 91.7 Minus
chrX 22417052 chrX 21400684..21401001 2181..1888 1115 91.5 Minus
chrU 10048995 chrU 1558690..1559003 1892..2181 1110 91.7 Plus
chrU 10048995 chrU 7346055..7346368 2181..1892 1110 91.7 Minus
chrU 10048995 chrU 1548061..1548369 1897..2181 1100 91.9 Plus
chr3LHet 2555433 chr3LHet 1671555..1671863 1897..2181 1100 91.9 Plus
chr3L 24539361 chr3L 20317124..20317432 2181..1897 1100 91.9 Minus
chr3L 24539361 chr3L 23814006..23814314 2181..1897 1100 91.9 Minus
chrU 10048995 chrU 6246909..6247217 1897..2181 1085 91.6 Plus
chr3L 24539361 chr3L 23061446..23061754 2181..1897 1085 91.6 Minus
chr3LHet 2555433 chr3LHet 2304812..2305125 1892..2181 1080 91.1 Plus
chr3LHet 2555433 chr3LHet 2314703..2315016 1892..2181 1080 91.1 Plus
chr3L 24539361 chr3L 20323570..20323885 2181..1889 1075 91.5 Minus
chrU 10048995 chrU 5673327..5673635 1897..2181 1070 91.3 Plus
chrU 10048995 chrU 7157078..7157386 1897..2181 1070 91.3 Plus
chr3L 24539361 chr3L 24213680..24213988 1897..2181 1070 91.3 Plus
chr2R 21145070 chr2R 5808003..5808209 1283..1077 1035 100 Minus
chrU 10048995 chrU 7155011..7155235 2028..2258 995 97.4 Plus
chrU 10048995 chrU 7743610..7743918 2181..1889 940 88.6 Minus
chrU 10048995 chrU 2940887..2941085 2290..2092 920 97.5 Minus
chrU 10048995 chrU 9768552..9768814 1897..2135 855 90.1 Plus
chrX 22417052 chrX 21400541..21400682 2290..2149 635 96.5 Minus
chrU 10048995 chrU 1548371..1548508 2149..2290 555 94.4 Plus
chrU 10048995 chrU 1559005..1559142 2149..2290 555 94.4 Plus
chrU 10048995 chrU 3899708..3899845 2290..2149 555 94.4 Minus
chrU 10048995 chrU 5673637..5673774 2149..2290 555 94.4 Plus
chrU 10048995 chrU 6247219..6247356 2149..2290 555 94.4 Plus
chrU 10048995 chrU 7743471..7743608 2290..2149 555 94.4 Minus
chr3LHet 2555433 chr3LHet 1665291..1665428 2149..2290 555 94.4 Plus
chr3LHet 2555433 chr3LHet 1671865..1672002 2149..2290 555 94.4 Plus
chr3L 24539361 chr3L 20316985..20317122 2290..2149 555 94.4 Minus
chr3L 24539361 chr3L 23068073..23068210 2290..2149 555 94.4 Minus
chr3L 24539361 chr3L 23813867..23814004 2290..2149 555 94.4 Minus
chr3L 24539361 chr3L 23820686..23820823 2290..2149 555 94.4 Minus
chr3L 24539361 chr3L 24186263..24186400 2149..2290 555 94.4 Plus
chr3L 24539361 chr3L 24207004..24207141 2149..2290 555 94.4 Plus
chr3L 24539361 chr3L 24213990..24214127 2149..2290 555 94.4 Plus
chr3LHet 2555433 chr3LHet 2305127..2305264 2149..2290 540 93.7 Plus
chr3LHet 2555433 chr3LHet 2315018..2315155 2149..2290 540 93.7 Plus
chrU 10048995 chrU 7157388..7157525 2149..2290 525 93 Plus
chrU 10048995 chrU 7345915..7346053 2290..2149 510 93.7 Minus
chr3L 24539361 chr3L 23061327..23061444 2270..2149 455 93.4 Minus
chr2RHet 3288813 chr2RHet 2587849..2588004 2032..2177 400 85.3 Plus
chrX 22417052 chrX 22375494..22375648 2278..2121 395 86.2 Minus
chrU 10048995 chrU 246899..246970 1956..1885 345 98.6 Minus
chrX 22417052 chrX 22375680..22375764 2112..2028 260 87.1 Minus
chr3L 24539361 chr3L 23703162..23703246 2028..2112 260 87.1 Plus
chr3LHet 2555433 chr3LHet 1182046..1182135 2028..2118 255 87.9 Plus
chr3L 24539361 chr3L 20323512..20323568 2205..2149 255 96.5 Minus
chrU 10048995 chrU 9162446..9162500 2203..2149 245 96.4 Minus
chr3LHet 2555433 chr3LHet 638765..638888 2278..2152 240 82.8 Minus
chr2L 23010047 chr2L 22111360..22111451 2122..2030 235 86 Minus
chr2RHet 3288813 chr2RHet 237915..238069 2273..2121 230 78.1 Minus
chr2RHet 3288813 chr2RHet 2799638..2799725 2117..2029 215 85.4 Minus
chr3LHet 2555433 chr3LHet 638889..638945 2177..2121 210 91.2 Minus
chr2RHet 3288813 chr2RHet 1563096..1563176 2029..2110 210 86.6 Plus
chr2RHet 3288813 chr2RHet 2588048..2588103 2203..2258 205 91.1 Plus
chr3RHet 2517486 chr3RHet 798947..799026 2107..2028 205 83.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RC 1548 CG1429-PC 1..581 1026..1606 2890 99.8 Plus
Mef2-RD 1623 CG1429-PD 1..581 1026..1606 2890 99.8 Plus
Mef2-RG 1536 CG1429-PG 1..577 1026..1602 2885 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:47:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-RG 5240 CG1429-RG 2120..3037 685..1602 4575 99.9 Plus
Mef2-RC 5854 CG1429-RC 717..1637 686..1606 4575 99.8 Plus
Mef2-RD 3690 CG1429-RD 1100..2020 686..1606 4575 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-PG 511 CG1429-PG 1..193 1026..1604 923 99.5 Plus
Mef2-PC 515 CG1429-PC 1..192 1026..1601 922 100 Plus
Mef2-PD 540 CG1429-PD 1..192 1026..1601 922 100 Plus
Mef2-PF 501 CG1429-PF 1..186 1026..1583 893 100 Plus
Mef2-PB 509 CG1429-PB 1..186 1026..1583 893 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9958124..9958808 685..1 3425 100 Minus
2R 25286936 2R 9919134..9919749 1897..1282 3050 99.7 Minus
2R 25286936 2R 1827498..1827905 1886..2293 2025 99.8 Plus
3L 28110227 3L 25738968..25739378 1883..2293 2025 99.5 Plus
3L 28110227 3L 11271017..11271423 2293..1887 2020 99.8 Minus
X 23542271 X 3760576..3760982 2293..1887 2020 99.8 Minus
2R 25286936 2R 9726657..9727065 1885..2293 2015 99.5 Plus
3L 28110227 3L 10067292..10067699 2293..1886 2010 99.5 Minus
3R 32079331 3R 5008740..5009150 2293..1883 2010 99.3 Minus
2R 25286936 2R 10948076..10948479 1890..2293 2005 99.8 Plus
3L 28110227 3L 1506041..1506450 1884..2293 2005 99.3 Plus
2R 25286936 2R 1716084..1716489 2293..1888 2000 99.5 Minus
Xmm 1049845 Xmm 161654..162056 2293..1891 2000 99.8 Minus
X 23542271 X 14304126..14304533 1886..2293 1995 99.3 Plus
2R 25286936 2R 2110558..2110959 1892..2293 1980 99.5 Plus
2R 25286936 2R 5909318..5909719 2293..1892 1980 99.5 Minus
2R 25286936 2R 9921606..9922004 1083..685 1980 99.7 Minus
2R 25286936 2R 1834505..1834901 1897..2293 1970 99.7 Plus
2R 25286936 2R 2117552..2117948 1897..2293 1970 99.7 Plus
2R 25286936 2R 10955065..10955461 1897..2293 1970 99.7 Plus
3L 28110227 3L 11264634..11265030 2293..1897 1970 99.7 Minus
X 23542271 X 3753590..3753986 2293..1897 1970 99.7 Minus
2R 25286936 2R 5902328..5902724 2293..1897 1955 99.5 Minus
2R 25286936 2R 9733651..9734047 1897..2293 1955 99.5 Plus
3L 28110227 3L 1513082..1513478 1897..2293 1955 99.5 Plus
3L 28110227 3L 10060282..10060678 2293..1897 1955 99.5 Minus
3L 28110227 3L 25744795..25745191 1897..2293 1955 99.5 Plus
Y 3667352 Y 3273904..3274300 2293..1897 1955 99.5 Minus
3R 32079331 3R 10804223..10804624 1892..2293 1950 99 Plus
2R 25286936 2R 1709102..1709498 2293..1897 1940 99.2 Minus
X 23542271 X 14309779..14310175 1897..2293 1940 99.2 Plus
3R 32079331 3R 5002500..5002896 2293..1897 1940 99.2 Minus
3R 32079331 3R 10811191..10811587 1897..2293 1925 99 Plus
Y 3667352 Y 3280857..3281261 2293..1888 1905 98.5 Minus
Y 3667352 Y 864038..864433 1897..2293 1890 99 Plus
Ymm 880023 Ymm 512108..512503 1897..2293 1890 99 Plus
U 3151297 U 1175192..1175533 2233..1892 1710 100 Minus
3R 32079331 3R 1273314..1273744 1883..2293 1635 93.3 Plus
Ymm 880023 Ymm 499316..499692 1897..2293 1620 94.5 Plus
2R 25286936 2R 669318..669697 2258..1885 1610 95.8 Minus
U 3151297 U 1988417..1988790 2258..1891 1595 96 Minus
3R 32079331 3R 1375350..1375717 1897..2258 1565 96 Plus
2R 25286936 2R 2693776..2694192 2293..1897 1550 92.9 Minus
2R 25286936 2R 662614..662981 2258..1897 1535 95.4 Minus
Ymm 880023 Ymm 142802..143218 2293..1897 1535 92.6 Minus
3R 32079331 3R 1368384..1368754 1892..2258 1525 95.5 Plus
3R 32079331 3R 1280223..1280639 1897..2293 1520 92.4 Plus
2R 25286936 2R 2700685..2701116 2293..1883 1515 92 Minus
Ymm 880023 Ymm 531711..532135 2293..1888 1515 92.3 Minus
Y 3667352 Y 1066801..1067154 1897..2244 1510 96.1 Plus
Ymm 880023 Ymm 145798..146214 2293..1897 1505 92.2 Minus
U 3151297 U 1360079..1360399 1971..2293 1485 98.8 Plus
3L 28110227 3L 27429156..27429506 2232..1888 1465 95.5 Minus
3CEN 744266 3CEN 388675..389025 1888..2232 1465 95.5 Plus
Ymm 880023 Ymm 151547..151938 2258..1887 1425 92.4 Minus
2R 25286936 2R 2381414..2381795 1897..2258 1390 92.5 Plus
2R 25286936 2R 2396106..2396487 1897..2258 1390 92.5 Plus
2R 25286936 2R 2402420..2402801 1897..2258 1390 92.5 Plus
2R 25286936 2R 2387728..2388109 1897..2258 1375 92.2 Plus
U 3151297 U 1156267..1156654 2258..1890 1335 91.6 Minus
U 3151297 U 1152599..1152969 1908..2258 1320 92 Plus
U 3151297 U 1373709..1374085 1905..2258 1250 91.6 Plus
2R 25286936 2R 3562422..3562843 2293..1892 1185 86.9 Minus
3L 28110227 3L 23831925..23832247 2181..1883 1170 92.3 Minus
3L 28110227 3L 24197035..24197354 1886..2181 1155 92.2 Plus
3L 28110227 3L 23079294..23079616 2181..1883 1140 91.6 Minus
3L 28110227 3L 24217775..24218094 1886..2181 1140 91.9 Plus
3L 28110227 3L 26317652..26317971 1886..2181 1140 91.9 Plus
3L 28110227 3L 20334482..20334798 2181..1889 1125 91.8 Minus
X 23542271 X 21535526..21535843 2181..1888 1115 91.5 Minus
3R 32079331 3R 339456..339773 1888..2181 1115 91.5 Plus
U 3151297 U 1893288..1893602 2181..1891 1115 91.7 Minus
2R 25286936 2R 108718..109031 2181..1892 1110 91.7 Minus
2R 25286936 2R 126234..126547 2181..1892 1110 91.7 Minus
2R 25286936 2R 119352..119660 2181..1897 1100 91.9 Minus
3L 28110227 3L 20328036..20328344 2181..1897 1100 91.9 Minus
3L 28110227 3L 23825106..23825414 2181..1897 1100 91.9 Minus
3L 28110227 3L 26324238..26324546 1897..2181 1100 91.9 Plus
3L 28110227 3L 23072528..23072836 2181..1897 1085 91.6 Minus
U 3151297 U 2821327..2821635 1897..2181 1085 91.6 Plus
3L 28110227 3L 27197486..27197799 1892..2181 1080 91.1 Plus
U 3151297 U 550677..550992 2181..1890 1075 90.8 Minus
3L 28110227 3L 24224772..24225080 1897..2181 1070 91.3 Plus
3R 32079331 3R 346429..346737 1897..2181 1070 91.3 Plus
3R 32079331 3R 349756..350064 1897..2181 1070 91.3 Plus
3R 32079331 3R 360914..361222 1897..2181 1070 91.3 Plus
Y 3667352 Y 3557985..3558293 1897..2181 1070 91.3 Plus
U 3151297 U 1158526..1158834 1897..2181 1070 91.3 Plus
2R 25286936 2R 9920519..9920725 1283..1077 1035 100 Minus
U 3151297 U 2886709..2886933 2028..2258 995 97.4 Plus
Ymm 880023 Ymm 350870..351178 1889..2181 955 89 Plus
Y 3667352 Y 3551566..3551805 1956..2181 925 93.3 Plus
U 3151297 U 839828..840090 1897..2135 855 90.1 Plus
X 23542271 X 21535380..21535524 2293..2149 650 96.6 Minus
Ymm 880023 Ymm 140023..140235 2085..1897 605 87.8 Minus
2R 25286936 2R 108576..108716 2293..2149 570 94.5 Minus
2R 25286936 2R 119210..119350 2293..2149 570 94.5 Minus
2R 25286936 2R 126092..126232 2293..2149 570 94.5 Minus
3L 28110227 3L 20327894..20328034 2293..2149 570 94.5 Minus
3L 28110227 3L 23079152..23079292 2293..2149 570 94.5 Minus
3L 28110227 3L 23824964..23825104 2293..2149 570 94.5 Minus
3L 28110227 3L 23831783..23831923 2293..2149 570 94.5 Minus
3L 28110227 3L 24197356..24197496 2149..2293 570 94.5 Plus
3L 28110227 3L 24218096..24218236 2149..2293 570 94.5 Plus
3L 28110227 3L 24225082..24225222 2149..2293 570 94.5 Plus
3L 28110227 3L 26317973..26318113 2149..2293 570 94.5 Plus
3L 28110227 3L 26324548..26324688 2149..2293 570 94.5 Plus
3R 32079331 3R 339775..339915 2149..2293 570 94.5 Plus
3R 32079331 3R 346739..346879 2149..2293 570 94.5 Plus
3R 32079331 3R 350066..350206 2149..2293 570 94.5 Plus
3R 32079331 3R 361224..361364 2149..2293 570 94.5 Plus
Ymm 880023 Ymm 351180..351320 2149..2293 570 94.5 Plus
U 3151297 U 550535..550675 2293..2149 570 94.5 Minus
U 3151297 U 2821637..2821777 2149..2293 570 94.5 Plus
Y 3667352 Y 3551807..3551947 2149..2293 555 93.8 Plus
Y 3667352 Y 3558295..3558435 2149..2293 555 93.8 Plus
3L 28110227 3L 27197801..27197940 2149..2292 550 93.8 Plus
U 3151297 U 1158836..1158976 2149..2293 540 93.1 Plus
3L 28110227 3L 23072409..23072526 2270..2149 455 93.4 Minus
2R 25286936 2R 3664835..3664990 2032..2177 400 85.3 Plus
2R 25286936 2R 3706256..3706411 2032..2177 400 85.3 Plus
X 23542271 X 22979411..22979565 2278..2121 395 86.2 Minus
2R 25286936 2R 669751..669822 1956..1885 345 98.6 Minus
3L 28110227 3L 23714256..23714340 2028..2112 260 87.1 Plus
3L 28110227 3L 20334424..20334480 2205..2149 255 96.5 Minus
3L 28110227 3L 25799380..25799469 2028..2118 255 87.9 Plus
X 23542271 X 22979597..22979676 2112..2033 250 87.5 Minus
U 3151297 U 1893232..1893286 2203..2149 245 96.4 Minus
3L 28110227 3L 25153309..25153432 2278..2152 240 82.8 Minus
2L 23513712 2L 22112820..22112911 2122..2030 235 86 Minus
2R 25286936 2R 1111167..1111321 2273..2121 230 78.1 Minus
3L 28110227 3L 27988789..27988876 2029..2117 215 85.4 Plus
2R 25286936 2R 2788019..2788099 2029..2110 210 86.6 Plus
3L 28110227 3L 25153433..25153489 2177..2121 210 91.2 Minus
2R 25286936 2R 3665034..3665089 2203..2258 205 91.1 Plus
2R 25286936 2R 3706455..3706510 2203..2258 205 91.1 Plus
3R 32079331 3R 2096419..2096498 2107..2028 205 83.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9959323..9960007 685..1 3425 100 Minus
2R 25260384 2R 9920333..9920948 1897..1282 3050 99.6 Minus
2R 25260384 2R 1827498..1827905 1886..2293 2025 99.7 Plus
3L 28103327 3L 25732068..25732478 1883..2293 2025 99.5 Plus
3L 28103327 3L 11264117..11264523 2293..1887 2020 99.7 Minus
X 23527363 X 3768674..3769080 2293..1887 2020 99.7 Minus
2R 25260384 2R 9727856..9728264 1885..2293 2015 99.5 Plus
3L 28103327 3L 10060392..10060799 2293..1886 2010 99.5 Minus
3R 31820162 3R 4749571..4749981 2293..1883 2010 99.2 Minus
2R 25260384 2R 10949275..10949678 1890..2293 2005 99.7 Plus
3L 28103327 3L 1506041..1506450 1884..2293 2005 99.2 Plus
2R 25260384 2R 1716084..1716489 2293..1888 2000 99.5 Minus
X 23527363 X 14312224..14312631 1886..2293 1995 99.2 Plus
2R 25260384 2R 2110558..2110959 1892..2293 1980 99.5 Plus
2R 25260384 2R 9922805..9923203 1083..685 1980 99.7 Minus
2R 25260384 2R 5910517..5910918 2293..1892 1980 99.5 Minus
2R 25260384 2R 10956264..10956660 1897..2293 1970 99.7 Plus
2R 25260384 2R 2117552..2117948 1897..2293 1970 99.7 Plus
2R 25260384 2R 1834505..1834901 1897..2293 1970 99.7 Plus
3L 28103327 3L 11257734..11258130 2293..1897 1970 99.7 Minus
X 23527363 X 3761688..3762084 2293..1897 1970 99.7 Minus
2R 25260384 2R 9734850..9735246 1897..2293 1955 99.4 Plus
2R 25260384 2R 5903527..5903923 2293..1897 1955 99.4 Minus
3L 28103327 3L 25737895..25738291 1897..2293 1955 99.4 Plus
3L 28103327 3L 1513082..1513478 1897..2293 1955 99.4 Plus
3L 28103327 3L 10053382..10053778 2293..1897 1955 99.4 Minus
Unmapped_scaffold_16 28895 Unmapped_scaffold_16 18761..19157 2293..1897 1955 99.4 Minus
Unimproved_211000022215961_38_732 694 Unimproved_211000022215961_38_732 295..691 1890..2286 1955 99.4 Plus
3R 31820162 3R 10545054..10545455 1892..2293 1950 99 Plus
2R 25260384 2R 1709102..1709498 2293..1897 1940 99.2 Minus
3R 31820162 3R 4743331..4743727 2293..1897 1940 99.2 Minus
X 23527363 X 14317877..14318273 1897..2293 1940 99.2 Plus
3R 31820162 3R 10552022..10552418 1897..2293 1925 98.9 Plus
Unmapped_scaffold_16 28895 Unmapped_scaffold_16 25714..26118 2293..1888 1915 98.5 Minus
Y 3410481 Y 1559872..1560267 1897..2293 1900 98.9 Plus
2R 25260384 2R 669318..669616 2258..1956 1415 98.3 Minus
3R 31820162 3R 1172997..1173295 1956..2258 1415 98.3 Plus
2R 25260384 2R 662614..662912 2258..1956 1400 98 Minus
3R 31820162 3R 1166036..1166332 1956..2258 1360 97.6 Plus
Y 3410481 Y 798795..799079 1956..2244 1360 98.6 Plus
3L 28103327 3L 27422256..27422528 2232..1956 1285 98.1 Minus
3R 31820162 3R 1071053..1071322 2020..2293 1270 98.1 Plus
2R 25260384 2R 2693776..2694045 2293..2020 1255 97.8 Minus
3R 31820162 3R 1077948..1078217 2020..2293 1255 97.8 Plus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 2780..3049 2293..2020 1240 97.4 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 5776..6045 2293..2020 1225 97 Minus
2R 25260384 2R 2700685..2700954 2293..2020 1210 96.7 Minus
2R 25260384 2R 2402567..2402801 2020..2258 1095 97.9 Plus
2R 25260384 2R 2396253..2396487 2020..2258 1095 97.9 Plus
2R 25260384 2R 2381561..2381795 2020..2258 1095 97.9 Plus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 11525..11759 2258..2020 1095 97.9 Minus
2R 25260384 2R 2387875..2388109 2020..2258 1080 97.4 Plus
2R 25260384 2R 9921718..9921924 1283..1077 1035 100 Minus
Unimproved_211000022215961_38_732 694 Unimproved_211000022215961_38_732 1..180 2114..2293 855 98.3 Plus
2R 25260384 2R 126234..126395 2181..2020 795 99.3 Minus
2R 25260384 2R 119352..119513 2181..2020 795 99.3 Minus
2R 25260384 2R 108718..108879 2181..2020 795 99.3 Minus
3L 28103327 3L 24190293..24190454 2020..2181 795 99.3 Plus
3L 28103327 3L 26317485..26317646 2020..2181 795 99.3 Plus
3L 28103327 3L 26310910..26311071 2020..2181 795 99.3 Plus
3L 28103327 3L 23825025..23825186 2181..2020 795 99.3 Minus
3L 28103327 3L 23818206..23818367 2181..2020 795 99.3 Minus
3L 28103327 3L 23065628..23065789 2181..2020 795 99.3 Minus
3L 28103327 3L 23072394..23072555 2181..2020 795 99.3 Minus
3L 28103327 3L 20327582..20327743 2181..2020 795 99.3 Minus
3L 28103327 3L 20321136..20321297 2181..2020 795 99.3 Minus
3R 31820162 3R 137190..137351 2020..2181 795 99.3 Plus
3L 28103327 3L 24211033..24211194 2020..2181 780 98.7 Plus
3R 31820162 3R 147481..147642 2020..2181 780 98.7 Plus
3R 31820162 3R 144154..144315 2020..2181 780 98.7 Plus
3R 31820162 3R 158639..158800 2020..2181 780 98.7 Plus
Y 3410481 Y 3370615..3370776 2181..2020 780 98.7 Minus
Y 3410481 Y 3377103..3377264 2181..2020 780 98.7 Minus
Unmapped_scaffold_38 28305 Unmapped_scaffold_38 3054..3215 2181..2020 780 98.7 Minus
2R 25260384 2R 3563729..3563890 2181..2020 765 98.1 Minus
3L 28103327 3L 24218019..24218180 2020..2181 765 98.1 Plus
3L 28103327 3L 27190738..27190899 2020..2181 765 98.1 Plus
X 23527363 X 21520618..21520779 2181..2020 765 98.1 Minus
X 23527363 X 21520472..21520616 2293..2149 650 96.5 Minus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 2827..2980 2020..2181 650 94.4 Plus
2R 25260384 2R 108576..108716 2293..2149 580 94.4 Minus
2R 25260384 2R 126092..126232 2293..2149 580 94.4 Minus
2R 25260384 2R 119210..119350 2293..2149 580 94.4 Minus
3L 28103327 3L 20320994..20321134 2293..2149 580 94.4 Minus
3L 28103327 3L 24218182..24218322 2149..2293 580 94.4 Plus
3L 28103327 3L 24211196..24211336 2149..2293 580 94.4 Plus
3L 28103327 3L 24190456..24190596 2149..2293 580 94.4 Plus
3L 28103327 3L 26317648..26317788 2149..2293 580 94.4 Plus
3L 28103327 3L 26311073..26311213 2149..2293 580 94.4 Plus
3L 28103327 3L 23824883..23825023 2293..2149 580 94.4 Minus
3L 28103327 3L 23818064..23818204 2293..2149 580 94.4 Minus
3L 28103327 3L 23072252..23072392 2293..2149 580 94.4 Minus
3R 31820162 3R 147644..147784 2149..2293 580 94.4 Plus
3R 31820162 3R 144317..144457 2149..2293 580 94.4 Plus
3R 31820162 3R 137353..137493 2149..2293 580 94.4 Plus
3R 31820162 3R 158802..158942 2149..2293 580 94.4 Plus
Unmapped_scaffold_38 28305 Unmapped_scaffold_38 2912..3052 2293..2149 580 94.4 Minus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 2982..3122 2149..2293 580 94.4 Plus
Y 3410481 Y 3370473..3370613 2293..2149 565 93.7 Minus
Y 3410481 Y 3376961..3377101 2293..2149 565 93.7 Minus
3L 28103327 3L 27190901..27191040 2149..2292 560 93.7 Plus
3L 28103327 3L 23065509..23065626 2270..2149 465 93.4 Minus
X 23527363 X 22964503..22964657 2278..2121 415 86.1 Minus
3L 28103327 3L 23825275..23825347 1955..1883 365 100 Minus
3R 31820162 3R 1070892..1070964 1883..1955 365 100 Plus
3L 28103327 3L 24190135..24190204 1886..1955 350 100 Plus
3L 28103327 3L 24210875..24210944 1886..1955 350 100 Plus
3L 28103327 3L 23072644..23072716 1955..1883 350 98.6 Minus
2R 25260384 2R 669751..669822 1956..1885 345 98.6 Minus
2R 25260384 2R 669627..669697 1955..1885 340 98.5 Minus
X 23527363 X 21520868..21520935 1955..1888 340 100 Minus
2R 25260384 2R 2387797..2387863 1956..2022 335 100 Plus
2R 25260384 2R 2381483..2381549 1956..2022 335 100 Plus
2R 25260384 2R 2700966..2701032 2022..1956 335 100 Minus
2R 25260384 2R 2694057..2694123 2022..1956 335 100 Minus
2R 25260384 2R 3563902..3563968 2022..1956 335 100 Minus
2R 25260384 2R 126407..126473 2022..1956 335 100 Minus
2R 25260384 2R 119525..119591 2022..1956 335 100 Minus
2R 25260384 2R 108891..108957 2022..1956 335 100 Minus
2R 25260384 2R 2402489..2402555 1956..2022 335 100 Plus
2R 25260384 2R 2396175..2396241 1956..2022 335 100 Plus
3L 28103327 3L 23065801..23065867 2022..1956 335 100 Minus
3L 28103327 3L 20327755..20327821 2022..1956 335 100 Minus
3L 28103327 3L 20321309..20321375 2022..1956 335 100 Minus
3L 28103327 3L 24190215..24190281 1956..2022 335 100 Plus
3L 28103327 3L 26317407..26317473 1956..2022 335 100 Plus
3L 28103327 3L 26310832..26310898 1956..2022 335 100 Plus
3L 28103327 3L 26310752..26310821 1886..1955 335 98.5 Plus
3L 28103327 3L 24210955..24211021 1956..2022 335 100 Plus
3L 28103327 3L 24217941..24218007 1956..2022 335 100 Plus
3L 28103327 3L 23825198..23825264 2022..1956 335 100 Minus
3L 28103327 3L 23818379..23818445 2022..1956 335 100 Minus
3R 31820162 3R 1070975..1071041 1956..2022 335 100 Plus
X 23527363 X 21520791..21520857 2022..1956 335 100 Minus
Y 3410481 Y 3370788..3370854 2022..1956 335 100 Minus
Y 3410481 Y 3377276..3377342 2022..1956 335 100 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 11771..11837 2022..1956 335 100 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 6057..6123 2022..1956 335 100 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 3061..3127 2022..1956 335 100 Minus
Unmapped_scaffold_38 28305 Unmapped_scaffold_38 3227..3293 2022..1956 335 100 Minus
2R 25260384 2R 3563621..3563692 2293..2222 330 97.2 Minus
3R 31820162 3R 1077871..1077936 1957..2022 330 100 Plus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 11848..11916 1955..1887 330 98.5 Minus
3L 28103327 3L 27422539..27422606 1955..1888 325 98.5 Minus
3R 31820162 3R 137034..137101 1888..1955 325 98.5 Plus
2R 25260384 2R 3563979..3564042 1955..1892 320 100 Minus
3L 28103327 3L 27190586..27190649 1892..1955 320 100 Plus
3L 28103327 3L 27190660..27190726 1956..2022 320 98.5 Plus
3L 28103327 3L 23072567..23072633 2022..1956 320 98.5 Minus
3R 31820162 3R 1165962..1166025 1892..1955 320 100 Plus
3R 31820162 3R 137112..137178 1956..2022 320 98.5 Plus
3R 31820162 3R 144076..144142 1956..2022 320 98.5 Plus
3R 31820162 3R 158561..158627 1956..2022 320 98.5 Plus
3R 31820162 3R 147403..147469 1956..2022 320 98.5 Plus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 78..144 2022..1956 320 98.5 Minus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 2749..2815 1956..2022 320 98.5 Plus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 2672..2738 1889..1955 320 98.5 Plus
2R 25260384 2R 2701043..2701116 1955..1883 315 97.2 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 1..66 2085..2020 315 98.4 Minus
2R 25260384 2R 126484..126547 1955..1892 305 98.4 Minus
2R 25260384 2R 108968..109031 1955..1892 305 98.4 Minus
2R 25260384 2R 2402420..2402478 1897..1955 295 100 Plus
2R 25260384 2R 2396106..2396164 1897..1955 295 100 Plus
2R 25260384 2R 2387728..2387786 1897..1955 295 100 Plus
3R 31820162 3R 1172928..1172986 1897..1955 295 100 Plus
3R 31820162 3R 158492..158550 1897..1955 295 100 Plus
3R 31820162 3R 147334..147392 1897..1955 295 100 Plus
3R 31820162 3R 144007..144065 1897..1955 295 100 Plus
Y 3410481 Y 798726..798784 1897..1955 295 100 Plus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 3138..3196 1955..1897 295 100 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 155..213 1955..1897 295 100 Minus
3R 31820162 3R 1077801..1077858 1897..1954 290 100 Plus
Unmapped_scaffold_38 28305 Unmapped_scaffold_38 3304..3369 1955..1890 285 95.4 Minus
Y 3410481 Y 3370865..3370923 1955..1897 280 98.3 Minus
Unmapped_scaffold_12 66439 Unmapped_scaffold_12 6134..6192 1955..1897 280 98.3 Minus
X 23527363 X 22964689..22964768 2112..2033 250 87.5 Minus
3R 31820162 3R 1893997..1894076 2107..2028 205 83.7 Minus
Y 3410481 Y 3377353..3377393 1924..1884 175 95.1 Minus
Blast to na_te.dros performed 2014-11-27 15:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 1..394 1897..2290 1961 99.7 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6928..7321 1897..2290 1961 99.7 Plus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 76..309 2029..2273 318 65.1 Plus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 6657..6890 2029..2273 318 65.1 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 226..303 2193..2273 181 74.4 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 6178..6255 2193..2273 181 74.4 Plus
Tom1 410 Tom1 DMTOM1_LTR 410bp 262..318 2223..2281 136 76.7 Plus

SD04091.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:02:54 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5845652..5846336 1..685 100   Minus
chr2R 5809097..5809490 686..1079 90 <- Minus
chr2R 5808003..5808206 1080..1283 100 <- Minus
chr2R 5806621..5807235 1284..1897 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:31:21 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1..582 1026..1607 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:57:24 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RC 1..585 1026..1611 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:25:59 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1..585 1026..1611 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:40:20 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1..582 1026..1607 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:02:54 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1..585 1026..1611 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:31:20 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1..1897 1..1897 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:57:24 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RC 699..1623 686..1611 99 == Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:25:59 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1100..2024 686..1611 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:40:20 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RE 1..1897 1..1897 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:02:54 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
Mef2-RD 1100..2024 686..1611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:02:54 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9958124..9958808 1..685 100   Minus
2R 9921610..9922003 686..1079 99 <- Minus
2R 9920519..9920722 1080..1283 100 <- Minus
2R 9919134..9919747 1284..1897 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:25:59 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5845629..5846313 1..685 100   Minus
arm_2R 5809115..5809508 686..1079 99 <- Minus
arm_2R 5808024..5808227 1080..1283 100 <- Minus
arm_2R 5806639..5807252 1284..1897 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:23:26 Download gff for SD04091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9959323..9960007 1..685 100   Minus
2R 9922809..9923202 686..1079 99 <- Minus
2R 9921718..9921921 1080..1283 100 <- Minus
2R 9920333..9920946 1284..1897 99 <- Minus

SD04091.hyp Sequence

Translation from 1025 to 1606

> SD04091.hyp
MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSS
SNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPE
AETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLP
VSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSGGMSLIS*

SD04091.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-PG 511 CG1429-PG 1..193 1..193 991 99.5 Plus
Mef2-PC 515 CG1429-PC 1..192 1..192 990 100 Plus
Mef2-PD 540 CG1429-PD 1..192 1..192 990 100 Plus
Mef2-PF 501 CG1429-PF 1..186 1..186 961 100 Plus
Mef2-PB 509 CG1429-PB 1..186 1..186 961 100 Plus

SD04091.pep Sequence

Translation from 1025 to 1606

> SD04091.pep
MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSS
SNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPE
AETDYTLTPRTEAKYNKIDEEFQNMMQRNQMAIGGAGAPRQLPNSSYTLP
VSVPVPGSYGDNLLQASPQMSHTNISPRPSSSETDSGGMSLIS*

SD04091.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11300-PA 620 GF11300-PA 1..187 1..186 984 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25246-PA 538 GG25246-PA 1..186 1..186 999 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21641-PA 529 GH21641-PA 1..191 1..186 926 94.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Mef2-PG 511 CG1429-PG 1..193 1..193 991 99.5 Plus
Mef2-PC 515 CG1429-PC 1..192 1..192 990 100 Plus
Mef2-PD 540 CG1429-PD 1..192 1..192 990 100 Plus
Mef2-PF 501 CG1429-PF 1..186 1..186 961 100 Plus
Mef2-PB 509 CG1429-PB 1..186 1..186 961 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20094-PA 549 GI20094-PA 1..201 1..186 900 88.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17706-PA 622 GL17706-PA 1..186 1..186 988 98.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Mef2-PB 520 GA12881-PB 1..186 1..186 992 98.4 Plus
Dpse\Mef2-PC 510 GA12881-PC 1..186 1..186 990 98.4 Plus
Dpse\Mef2-PA 543 GA12881-PA 1..186 1..186 990 98.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20566-PA 532 GM20566-PA 1..186 1..186 1009 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10037-PA 532 GD10037-PA 1..186 1..186 1009 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19861-PA 572 GJ19861-PA 1..205 1..186 917 86.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15831-PA 627 GK15831-PA 1..203 1..186 916 89.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21918-PA 534 GE21918-PA 1..186 1..186 1004 99.5 Plus