Clone SD04321 Report

Search the DGRC for SD04321

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:43
Well:21
Vector:pOT2
Associated Gene/Transcriptcnc-RF
Protein status:SD04321.pep: full length peptide match
Sequenced Size:3636

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
cnc-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

SD04321.complete Sequence

3636 bp assembled on 2009-08-31

GenBank Submission: BT099672.1

> SD04321.complete
GAATTTCCAGCAAGCAAAATAGAAACGAAGCGAAGAACAAGGACAACGAT
CCGGAGAAAGCTGACGGCGATAGCTTCTCGGTGAGCGATTTCGAGGAACT
TCAAAATTCTGTGGGCTCGCCCCTGTTTGACTTAGATGAGGACGCCAAGA
AGGAACTAGACGAGATGTTGCAATCAACGGTTCCGTCATACCACCATCCC
CATCCGCATCACGGCCACCCTCATGCTCATCCCCATAGCCACCACCATGC
GTCGATGCACCATGCCCATGCCCACCATGCTGCCGCTGCAGCTGCCGCCC
ACCAGCGTGCGGTGCAGCAGGCCAACTATGGTGGTGGAGTCGGCGTGGGC
GTTGGCGTCGGTGTGGGCGTGGGCAGTGGCACGGGCAGCGCCTTCCAGAG
GCAGCCAGCTGCCGGCGGATTCCATCATGGCCATCATCAGGGCCGCATGC
CGCGTCTGAATCGCAGCGTTTCGATGGAGCGTCTTCAGGACTTTGCCACC
TACTTCAGTCCCATTCCGAGCATGGTGGGCGGGGTATCCGATATGTCACC
GTATCCGCACCACTATCCCGGCTACTCCTATCAGGCGAGTCCCTCGAACG
GAGCACCCGGCACTCCTGGCCAGCATGGTCAGTATGGCAGTGGCGCCAAT
GCTACCTTGCAGCCACCACCACCACCGCCGCCGCCGCATCACGCTGCCAT
GTTGCATCACCCGAATGCCGCCTTGGGCGACATCTGCCCCACCGGGCAGC
CCCACTACGGGCACAATCTGGGATCGGCTGTCACCTCCAGCATGCATCTG
ACCAACTCCAGTCACGAGGCCGATGGAGCCGCCGCTGCTGCTGCCGCCTA
CAAAGTGGAGCACGATTTGATGTACTACGGGAACACCTCATCGGACATTA
ACCAGACGGATGGCTTTATTAACTCCATTTTTACCGACGAGGATCTGCAC
TTGATGGACATGAATGAGAGCTTCTGTCGCATGGTTGACAACAGCACTAG
CAACAACTCCTCGGTTCTGGGCTTGCCCAGCAGTGGACATGTTAGCAACG
GCTCCGGTAGCTCGGCACAACTTGGGGCGGGAAATCCGCACGGTAACCAG
GCCAACGGAGCGTCCGGCGGCGTTGGCTCGATGAGCGGATCAGCTGTGGG
CGCTGGAGCTACGGGAATGACCGCCGATCTTTTGGCAAGCGGCGGTGCAG
GAGCACAAGGCGGTGCGGATCGCTTGGACGCGTCCAGCGACAGTGCTGTC
AGTTCGATGGGCTCCGAGCGAGTGCCGTCCCTCTCCGACGGCGAGTGGGG
TGAGGGCAGTGACTCCGCCCAGGATTACCATCAGGGCAAGTACGGAGGCC
CCTACGACTTCAGCTACAACAATAATTCACGGCTTAGCACCGCCACACGT
CAGCCGCCGGTGGCGCAGAAGAAGCATCAGCTGTACGGCAAGAGGGATCC
CCATAAGCAGACGCCATCGGCTTTGCCACCAACAGCTCCACCAGCAGCCG
CGACTGCAGTCCAATCGCAGAGTATCAAGTACGAGTACGATGCTGGGTAC
GCCTCCTCGGGAATGGCCAGCGGTGGAATCAGTGAGCCAGGAGCGATGGG
ACCCGCTCTATCCAAGGACTATCATCATCATCAGCCTTACGGCATGGGAG
CCAGCGGCAGCGCCTTTTCCGGCGACTATACAGTACGACCATCGCCAAGG
ACTTCGCAGGATTTGGTGCAACTAAATCATACCTACTCGCTACCCCAGGG
AAGTGGATCCCTTCCCAGACCCCAGGCACGCGATAAGAAGCCCCTGGTCG
CCACTAAAACCGCATCGAAGGGAGCGAGTGCCGGCAACAGCAGCAGTGTT
GGCGGAAACAGCAGCAACTTGGAGGAAGAGCATCTGACACGCGATGAAAA
GCGCGCTCGATCCCTGAACATACCCATTTCAGTGCCGGACATCATTAACC
TGCCCATGGACGAGTTCAACGAGCGCTTGTCGAAATACGACCTTAGCGAG
AACCAGTTGTCGCTGATTCGCGACATTCGTCGGCGTGGAAAGAACAAGGT
CGCTGCCCAGAATTGCAGGAAACGCAAATTGGACCAGATCCTGACTCTAG
AGGATGAGGTGAACGCGGTGGTTAAGCGCAAGACCCAACTTAATCAGGAC
CGCGATCATTTGGAGAGCGAACGCAAGCGCATCTCGAACAAGTTTGCCAT
GCTGCATCGTCATGTCTTCCAGTACCTACGGGATCCCGAGGGAAATCCCT
GCTCGCCGGCGGACTACAGTTTGCAACAGGCTGCCGATGGCTCCGTCTAC
TTGCTACCACGTGAAAAGTCCGAGGGTAACAACACGGCTACGGCTGCCTC
CAATGCTGTTTCGTCGGCCAGTGGGGGAAGTCTTAATGGCCACGTGCCCA
CTCAGGCTCCCATGCACAGCCATCAGAGCCACGGAATGCAGGCGCAACAT
GTTGTCGGTGGGATGTCGCAGCAGCAGCAACAGCAGTCGAGGCTGCCTCC
ACACCTGCAACAGCAGCATCATCTGCAGTCGCAGCAACAGCAGCCGGGAG
GTCAGCAGCAACAGCAGCACCGCAAGGAATGAAAGTACCTGTTGCGAATT
GCCGCAACTAAGAGTTGGTTCACTAGTTTCCAGCGCGGGCAGCAGCATCG
ATCCGTGCAGCAGCAACAGCAACAGTTTGATTACCGCTACGATATGATGA
ACAACAGTTATCTGTACTACTGAGCGGCGATTTGGATATTCTACTTCTTG
TTTTAGATGCCACATGTTGCTGGCAACATTTGTTGCACCCGCTGCTTTCG
GCCCATTGGAGCTCTTTCATTTATCGCACCAATCCTCCCATTAATGGTTT
ACTCATTTAGTCAGCATGATTGTTATTTATTTTTTAATTAATTGATTATT
TGGACTCGTCCAAGTCCGTCTTGCATGGTGTTGTCCCTTCTGGACAGCGT
ATGCGAAGCCTTTTACTTAATTGCAATTAATGAAAAACAAAACTTGTGAT
AAAACAGCTCTTTTACTCCGAAATATTTGCGCCCCAAAGGTCAAGCTGAC
AGAAAAATGTGCGAAAAAAATAGATCCGAAAAGAATGTAATTAAATATGC
TTCACATGAATTTGTAAATCAGTAAACAACTCACATTCAGAACCAATCCC
ACTTATCCATTCTTCATCGTCGCGTCGTCCAACAATATTTGATGGTGAAA
CCGTTTACATCTCTATAATATTAGCTTGTAAAATATGAAAACACAAAGAT
GGATGAAGAGAAAAATGTATAAAATAGAGGATAGGAAAATACACACACAC
AAAACTATTGTAAAGGTTGAAAATATTGCTGGACATTTCATGAATTACGG
GCGTAAGACATTTACATTTGTAAGCTATATTCTAGTGAAAGATCTACCAC
AGCGGTGAATAGTTGTAAATCGTTCTAAACTCATAAGGCATTTATCAAAA
TCCCATACACAAAAAATAACACAAATTATCACTTTCGAGCTAGCACACAG
CATCTGTAAATACATAATTTAAACTTAGCTAACATTTAATAAACCAGCGC
TAGGCTAAAGCAACAATGAGTGTGCTAACACACCTCAAAGAAACTAAAGA
AAATACTAAACAAAAAAAAAAAAAAAAAAAAAAAAA

SD04321.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RB 5191 cnc-RB 744..4374 1..3628 17850 99.5 Plus
cnc.a 6746 cnc.a 2299..5929 1..3628 17850 99.5 Plus
cnc.c 5562 cnc.c 1115..4745 1..3628 17850 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19009826..19011217 3611..2220 6915 99.8 Minus
chr3R 27901430 chr3R 19011288..19012540 2222..970 6235 99.8 Minus
chr3R 27901430 chr3R 19015262..19015705 881..438 2220 100 Minus
chr3R 27901430 chr3R 19020708..19021148 441..1 2190 99.8 Minus
chr3R 27901430 chr3R 19015116..19015205 970..881 450 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RO 4293 CG43286-PO 1571..4293 1..2723 13480 99.7 Plus
cnc-RN 3402 CG43286-PN 821..3402 1..2582 12775 99.7 Plus
cnc-RM 3402 CG43286-PM 821..3402 1..2582 12775 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:48:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 4746 CG43286-RN 1133..4746 1..3611 17745 99.5 Plus
cnc-RM 4737 CG43286-RM 1124..4737 1..3611 17745 99.5 Plus
cnc-RO 6701 CG43286-RO 2256..5869 1..3611 17745 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-PO 1430 CG43286-PO 525..1430 3..2720 2808 99.8 Plus
cnc-PL 1046 CG43286-PL 188..1008 3..2465 2682 99.9 Plus
cnc-PB 805 CG17894-PB 47..767 303..2465 2499 100 Plus
cnc-PP 711 CG43286-PP 1..673 447..2465 2439 100 Plus
cnc-PH 533 CG43286-PH 1..495 981..2465 1730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23186395..23187806 3628..2220 6855 99.4 Minus
3R 32079331 3R 23187877..23189129 2222..970 6220 99.8 Minus
3R 32079331 3R 23191841..23192284 881..438 2175 99.3 Minus
3R 32079331 3R 23197286..23197726 441..1 2175 99.5 Minus
3R 32079331 3R 23191695..23191784 970..881 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22927226..22928637 3628..2220 6875 99.3 Minus
3R 31820162 3R 22928708..22929960 2222..970 6220 99.7 Minus
3R 31820162 3R 22938117..22938557 441..1 2175 99.5 Minus
3R 31820162 3R 22932672..22933115 881..438 2175 99.3 Minus
3R 31820162 3R 22932526..22932615 970..881 450 100 Minus
Blast to na_te.dros performed 2014-11-27 11:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6869 2469..2589 249 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2289..2468 2403..2575 226 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6927 2469..2680 225 61.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6886 2469..2579 222 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2427 2469..2571 207 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6944 2468..2565 202 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6900 2469..2569 198 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6817..6931 2468..2579 198 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2668 2468..2677 192 60.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2781..2986 2469..2674 185 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2409..2513 2469..2575 178 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2516 2469..2610 176 61.1 Plus
roo 9092 roo DM_ROO 9092bp 1090..1163 2468..2541 154 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2594..2665 2468..2539 144 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2805..2916 2469..2580 137 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2422 2631..2706 121 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1539..1587 2472..2520 119 71.4 Plus

SD04321.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:55:16 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19020709..19021148 1..440 99   Minus
chr3R 19015262..19015702 441..881 100 <- Minus
chr3R 19015117..19015204 882..969 100 <- Minus
chr3R 19011288..19012540 970..2222 99 <- Minus
chr3R 19010970..19011214 2223..2467 100 <- Minus
chr3R 19009851..19010867 2570..3586 96 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:54:09 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RC 1571..4152 1..2582 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:10:56 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RC 1571..4152 1..2582 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:29 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 1571..4293 1..2723 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:55:16 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 1571..4293 1..2723 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:54:08 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RB 685..4298 1..3611 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:10:56 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RB 685..4298 1..3611 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:29 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 2256..5869 1..3611 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:55:16 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 2256..5869 1..3611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:55:16 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23197287..23197726 1..440 99   Minus
3R 23191841..23192281 441..881 99 <- Minus
3R 23191696..23191783 882..969 100 <- Minus
3R 23187877..23189129 970..2222 99 <- Minus
3R 23186412..23187803 2223..3611 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:29 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19023009..19023448 1..440 99   Minus
arm_3R 19017563..19018003 441..881 99 <- Minus
arm_3R 19017418..19017505 882..969 100 <- Minus
arm_3R 19013599..19014851 970..2222 99 <- Minus
arm_3R 19012134..19013525 2223..3611 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:02:18 Download gff for SD04321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22938118..22938557 1..440 99   Minus
3R 22932672..22933112 441..881 99 <- Minus
3R 22932527..22932614 882..969 100 <- Minus
3R 22928708..22929960 970..2222 99 <- Minus
3R 22927243..22928634 2223..3611 99 <- Minus

SD04321.hyp Sequence

Translation from 2 to 2581

> SD04321.hyp
ISSKQNRNEAKNKDNDPEKADGDSFSVSDFEELQNSVGSPLFDLDEDAKK
ELDEMLQSAVPSYHHPHPHHGHPHAHPHSHHHASMHHAHAHHAAAAAAAH
QRAVQQANYGGGVGVGVGVGVGVGSGTGSAFQRQPAAGGFHHGHHQGRMP
RLNRSVSMERLQDFATYFSPIPSMVGGVSDMSPYPHHYPGYSYQASPSNG
APGTPGQHGQYGSGANATLQPPPPPPPPHHAAMLHHPNAALGDICPTGQP
HYGHNLGSAVTSSMHLTNSSHEADGAAAAAAAYKVEHDLMYYGNTSSDIN
QTDGFINSIFTDEDLHLMDMNESFCRMVDNSTSNNSSVLGLPSSGHVSNG
SGSSAQLGAGNPHGNQANGASGGVGSMSGSAVGAGATGMTADLLASGGAG
AQGGADRLDASSDSAVSSMGSERVPSLSDGEWGEGSDSAQDYHQGKYGGP
YDFSYNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAA
TAVQSQSIKYEYDAGYASSGMASGGISEPGAMGPALSKDYHHHQPYGMGA
SGSAFSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPRPQARDKKPLVA
TKTASKGASAGNSSSVGGNSSNLEEEHLTRDEKRARSLNIPISVPDIINL
PMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLE
DEVNAVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPC
SPADYSLQQAADGSVYLLPREKSEGNNTATAASNAVSSASGGSLNGHVPT
QAPMHSHQSHGMQAQHVVGGMSQQQQQQSRLPPHLQQQHHLQSQQQQPGG
QQQQQHRKE*

SD04321.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-PN 1133 CG43286-PN 275..1133 1..859 4561 100 Plus
cnc-PM 1133 CG43286-PM 275..1133 1..859 4561 100 Plus
cnc-PO 1430 CG43286-PO 525..1383 1..859 4561 100 Plus
cnc-PL 1046 CG43286-PL 188..1046 1..859 4561 100 Plus
cnc-PK 1383 CG43286-PK 525..1383 1..859 4561 100 Plus

SD04321.pep Sequence

Translation from 2 to 2581

> SD04321.pep
ISSKQNRNEAKNKDNDPEKADGDSFSVSDFEELQNSVGSPLFDLDEDAKK
ELDEMLQSTVPSYHHPHPHHGHPHAHPHSHHHASMHHAHAHHAAAAAAAH
QRAVQQANYGGGVGVGVGVGVGVGSGTGSAFQRQPAAGGFHHGHHQGRMP
RLNRSVSMERLQDFATYFSPIPSMVGGVSDMSPYPHHYPGYSYQASPSNG
APGTPGQHGQYGSGANATLQPPPPPPPPHHAAMLHHPNAALGDICPTGQP
HYGHNLGSAVTSSMHLTNSSHEADGAAAAAAAYKVEHDLMYYGNTSSDIN
QTDGFINSIFTDEDLHLMDMNESFCRMVDNSTSNNSSVLGLPSSGHVSNG
SGSSAQLGAGNPHGNQANGASGGVGSMSGSAVGAGATGMTADLLASGGAG
AQGGADRLDASSDSAVSSMGSERVPSLSDGEWGEGSDSAQDYHQGKYGGP
YDFSYNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAA
TAVQSQSIKYEYDAGYASSGMASGGISEPGAMGPALSKDYHHHQPYGMGA
SGSAFSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPRPQARDKKPLVA
TKTASKGASAGNSSSVGGNSSNLEEEHLTRDEKRARSLNIPISVPDIINL
PMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLE
DEVNAVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPC
SPADYSLQQAADGSVYLLPREKSEGNNTATAASNAVSSASGGSLNGHVPT
QAPMHSHQSHGMQAQHVVGGMSQQQQQQSRLPPHLQQQHHLQSQQQQPGG
QQQQQHRKE*

SD04321.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18025-PA 1395 GF18025-PA 521..1354 1..822 3064 85.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12453-PA 1396 GG12453-PA 525..1350 1..821 3452 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21438-PA 1373 GH21438-PA 523..1341 9..833 1995 61.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-PN 1133 CG43286-PN 275..1133 1..859 4557 99.9 Plus
cnc-PM 1133 CG43286-PM 275..1133 1..859 4557 99.9 Plus
cnc-PO 1430 CG43286-PO 525..1383 1..859 4557 99.9 Plus
cnc-PL 1046 CG43286-PL 188..1046 1..859 4557 99.9 Plus
cnc-PK 1383 CG43286-PK 525..1383 1..859 4557 99.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10508-PA 1384 GI10508-PA 523..1298 18..774 2156 65.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23043-PA 974 GL23043-PA 57..793 101..835 2514 77.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14711-PA 1403 GA14711-PA 549..1373 23..835 2644 75.1 Plus
Dpse\GA14711-PC 823 GA14711-PC 57..793 101..835 2536 77.5 Plus
Dpse\GA14711-PB 533 GA14711-PB 1..503 327..835 1781 77.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23585-PA 413 GM23585-PA 15..384 461..830 1686 97.8 Plus
Dsec\GM23584-PA 953 GM23584-PA 529..923 9..403 1495 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\fzo-PA 983 GD18399-PA 133..983 9..859 4426 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23189-PA 1386 GJ23189-PA 522..1283 9..772 2123 66.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13231-PA 1418 GK13231-PA 557..1384 1..833 2574 71.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23976-PA 1385 GE23976-PA 521..1345 1..822 3460 94.7 Plus