Clone SD08175 Report

Search the DGRC for SD08175

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:81
Well:75
Vector:pOT2
Associated Gene/TranscriptBgb-RA
Protein status:SD08175.pep: gold
Preliminary Size:1484
Sequenced Size:1271

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7959 2001-01-01 Release 2 assignment
CG7959 2001-09-19 Blastp of sequenced clone
CG7959 2003-01-01 Sim4 clustering to Release 3
Bgb 2008-04-29 Release 5.5 accounting
Bgb 2008-08-15 Release 5.9 accounting
Bgb 2008-12-18 5.12 accounting

Clone Sequence Records

SD08175.complete Sequence

1271 bp (1271 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058784

> SD08175.complete
CCGCGTCAGTTGGTATATCAAAACCGCAAACCAACCTTTTTGTTGTATTG
TGCGTTGTTTTTTTCGACGGAGGCGAGAAATTTAAACAATTAGCATTCAG
AGTGCTAAGATACAAGAGCTTATTGTGTATACGCAGAAGGCTCGTCGAAG
GAGCGACCAAAAGAAACCCATCCAGGGTACCGAGTTCCAGGGATTATTGT
GTGCACGCAGCGGTCTGCAGAAGCACCCATAGAAACATACCCTATTCAGC
GTTCCATCGAGCGGACGAATCGCGAAAACCCGTTAAAATGATGAACGAGG
CGGCACTTGCCAATATGATACCCTACGACACCATCGGATTGTATGAACAG
CCAAAGCCGCGCTTCATCTTCAAGATGCCTCGTGTGGTCCCGGACCAGAA
GTCCAAGTTCGAGAGCGACGAACTTTTCCGGAGGCTCAGTCGGGAGAGCG
AGGTTCGGTACACGGGCTATCGGGAACGAAGCATCGAGGAGCGGCAGGTG
CGCTTCATGAACGGATGTCGCGAAGGACACACGGAGGCCAGCTTCGTGGC
ATCGGGCACCAATCTGCAGCTGGTGTTCAACGCCAACCAGAACCCGTACC
TGCACGACAAGGAGTGCGACTTTGACAAGGAGCACGGCAAGGTGCACATC
AAGTCCTACTTTATCATGAACGGGGTTTGTGTCCGGTTCCGTGGATGGAT
AGACCTGGAACGACTGGACGGAGTTGGCTGTCTGGAGTATGACGAGCGGC
GCGCCATGCACGAGGACGCCATTCTGCGGGATCAGATCGATCGCTACAAC
CAGCGACTGCGTGAGTTCGAGGACACTAAGCGCGCCTACCGTGACAATCG
ACAGGACGAGATGGAGGCAGTGCGACGGGGCGTGGCCTCCGGAGGCATTG
GCGTTGGCGCCAGCATGTGGCGTCGTTAGTTGGACCTGTGGACGGCTCCT
GGGCCGTCCCATCCGCAGCTGCCTCCCCAGCAGCAGCAGACGCATCACCA
GCAGTTAGAGACTCAATTCGCGAATACTCAATATTTCATGGACAACTGAG
AATGCTCCGAACCCCTTAAGAGGGCTTTCACTTGAGAGATTTCAATACGA
TTACGTTAGACACGCTCGAATAATTATGCTCCTAGATTAGTGTTAGATGT
AATGCTTACTTTACGTATGCTTTTATGGTATTATACTTACAACTTAGTGT
GAAATTAGTGTCGTATCTTTAACTAAAATACATAATTACTAATCTAAAAA
AAAAAAAAAAAAAAAAAAAAA

SD08175.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-RA 1266 Bgb-RA 22..1266 1..1245 6225 100 Plus
Bro-RA 745 Bro-RA 110..248 340..478 335 82.7 Plus
Bro-RA 745 Bro-RA 433..575 663..805 190 75.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1639304..1640548 1..1245 6150 99.6 Plus
chr3L 24539361 chr3L 1647571..1648036 340..805 440 73 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-RB 762 CG7959-PB 1..762 288..1049 3810 100 Plus
Bgb-RA 642 CG7959-PA 1..642 288..929 3210 100 Plus
Bro-RA 642 CG7960-PA 74..539 340..805 425 72.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:52:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-RB 1242 CG7959-RB 1..1242 4..1245 6210 100 Plus
Bgb-RA 1242 CG7959-RA 1..1242 4..1245 6210 100 Plus
Bro-RA 744 CG7960-RA 110..575 340..805 425 72.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-PB 253 CG7959-PB 1..253 288..1046 1131 99.6 Plus
Bgb-PA 213 CG7959-PA 1..213 288..926 1040 100 Plus
Bro-PA 213 CG7960-PA 11..183 300..815 683 71.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1639708..1640953 1..1246 6230 100 Plus
3L 28110227 3L 1647978..1648443 340..805 425 72.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1639708..1640953 1..1246 6230 100 Plus
3L 28103327 3L 1647978..1648116 340..478 335 82.7 Plus
3L 28103327 3L 1648301..1648443 663..805 190 75.5 Plus
Blast to na_te.dros performed 2014-11-26 23:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1064..1109 960..1005 131 76.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1539..1610 960..1031 117 62.5 Plus

SD08175.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:32:39 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1639304..1640548 1..1245 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:16 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 1..642 288..929 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:57:28 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 1..642 288..929 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:46 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RB 1..762 288..1049 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:43 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 1..642 288..929 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:39 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RB 1..762 288..1049 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:43:53 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 7..1247 1..1241 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:57:28 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 22..1266 1..1245 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:46 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 1..1242 4..1245 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:43 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 7..1247 1..1241 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:39 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
Bgb-RA 1..1242 4..1245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:32:39 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1639708..1640952 1..1245 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:46 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1639708..1640952 1..1245 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:56 Download gff for SD08175.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1639708..1640952 1..1245 100   Plus

SD08175.hyp Sequence

Translation from 2 to 928

> SD08175.hyp
ASVGISKPQTNLFVVLCVVFFDGGEKFKQLAFRVLRYKSLLCIRRRLVEG
ATKRNPSRVPSSRDYCVHAAVCRSTHRNIPYSAFHRADESRKPVKMMNEA
ALANMIPYDTIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESE
VRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNANQNPYL
HDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERR
AMHEDAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRRGVASGGIG
VGASMWRR*

SD08175.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-PA 213 CG7959-PA 1..213 96..308 1132 100 Plus
Bgb-PB 253 CG7959-PB 1..213 96..308 1132 100 Plus
Bro-PA 213 CG7960-PA 11..202 100..293 684 65.1 Plus

SD08175.pep Sequence

Translation from 287 to 928

> SD08175.pep
MMNEAALANMIPYDTIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRL
SRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNAN
QNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLE
YDERRAMHEDAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRRGVA
SGGIGVGASMWRR*

SD08175.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24819-PA 213 GF24819-PA 1..213 1..213 1129 98.1 Plus
Dana\GF24821-PA 214 GF24821-PA 7..188 1..184 699 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14808-PA 213 GG14808-PA 1..213 1..213 1140 100 Plus
Dere\GG14810-PA 213 GG14810-PA 11..213 5..211 690 63.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15954-PA 214 GH15954-PA 1..214 1..213 1124 98.6 Plus
Dgri\GH15956-PA 211 GH15956-PA 15..186 10..184 690 72.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Bgb-PA 213 CG7959-PA 1..213 1..213 1132 100 Plus
Bgb-PB 253 CG7959-PB 1..213 1..213 1132 100 Plus
Bro-PA 213 CG7960-PA 11..202 5..198 684 65.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16606-PA 214 GI16606-PA 1..214 1..213 1119 97.7 Plus
Dmoj\GI16609-PA 206 GI16609-PA 8..179 10..184 696 72 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20806-PA 213 GL20806-PA 1..213 1..213 1133 98.6 Plus
Dper\GL11917-PA 213 GL11917-PA 9..201 3..197 682 64.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20722-PA 213 GA20722-PA 1..213 1..213 1133 98.6 Plus
Dpse\GA23814-PA 213 GA23814-PA 9..201 3..197 679 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14430-PA 213 GM14430-PA 1..213 1..213 1140 100 Plus
Dsec\GM14432-PA 213 GM14432-PA 11..213 5..211 693 63.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17621-PA 213 GD17621-PA 1..213 1..213 1140 100 Plus
Dsim\GD13634-PA 213 GD13634-PA 9..213 3..211 697 63.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12861-PA 214 GJ12861-PA 1..214 1..213 1123 98.1 Plus
Dvir\GJ12863-PA 226 GJ12863-PA 21..200 3..184 687 69.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24387-PA 214 GK24387-PA 1..214 1..213 1115 97.2 Plus
Dwil\GK23643-PA 214 GK23643-PA 1..214 1..213 1039 95.3 Plus
Dwil\GK24398-PA 204 GK24398-PA 7..196 2..192 677 67.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21171-PA 213 GE21171-PA 1..213 1..213 1140 100 Plus
Dyak\GE21173-PA 213 GE21173-PA 11..213 5..211 688 63 Plus