Clone SD08423 Report

Search the DGRC for SD08423

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:84
Well:23
Vector:pOT2
Associated Gene/Transcripttth-RB
Protein status:SD08423.pep: gold
Preliminary Size:2931
Sequenced Size:2946

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12175 2001-10-10 Blastp of sequenced clone
CG12175 2003-01-01 Sim4 clustering to Release 3
tth 2008-04-29 Release 5.5 accounting
tth 2008-08-15 Release 5.9 accounting
tth 2008-12-18 5.12 accounting

Clone Sequence Records

SD08423.complete Sequence

2946 bp (2946 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061619

> SD08423.complete
TGAAAACGACGTTAATATTTCTGATCAATTAAACAATTGGAAAATCCGGC
CGCAGATCGCGATCTAAACGTATCGCCCTCGCCACGCCCACTGCCGCCCA
CGCCCCCTGGCGCGGGGTCACATCGATAGAGAGCTTTGCGTGTGTGTGTG
TGTGCGTGCGTGTATGTGTCGGTCGAGAGGAGAGGTGGAAGACGAAGAAG
AGTAAAAAAAACAGGCAGCGAAAAGCGATAAGAAACGGAACACAACACAC
TGGAAAAAAATTGCGATAAGAAACGGGGCGGAGCGGAGCGGAAATTGCCA
AGACTCTGGGATGGATTAGCGGCACAGCCGGACTCTGAGGTTAGCCAACA
GTGGGATTAGGACCAGGAACAGCCATGTCCTCCGCCGTTAACATCCAGAT
CGTCTCTATGCCGAATCTGGCCAAGATCGAGAGCTTCCTGAAGGATGTCA
GCTACCGGGAGACGATCGAGTACAGTGCCAACTTCAACACGCGCTTGTGC
AGCGAACGGCGCCACCGGCTGCCCTTCCTCGATCCGCAGACAGGCGTCGC
CCAGAACCACTCGCAGCTCTTCCTGGACAAGCGACAGCGGATGCCCGGCT
TCCGGCAGGGCCAGATCTACACGTATCCGGCGGCCCGCTGGCGGAAGAGC
CGTCGTCAGTACTTGAGCAAGATGTACAGCCGCTTTCCCGAGCGTCCCTT
CCAGGCGCTACGCAAGGAGCACGAAGCTCTGGTGGCCAGCGGCGTCAATC
TGGGACTGAGCAGCCTGACCAGCGGTGTGGGCTCCATGCCCGGCAGCAAT
AGCCTGGCCAGCAGCTCCTCCCTAACGCTCAATATGCTTACGGGCGGCGG
AGCCGCGCCGGCCGTACTTGGTTCCCTGCACAGTGACACTGCCCACGATT
TTAATGGAGCCTTCAGCCTGGAGGAGTCCAGCTCGCTGGGTGCCGCCGGC
GGTGATACATCCGACAGCAAGGACAGTCAACAGCAACAACATCAGCAGCA
CCAGCACCAGCAGCAGGCCGTCAAAGAGGAGCTTTTGCCCAAGGAGTGGT
TCTACGATGACATGGATATGAACGATGTGGACTCGCTGGAGGAGCCCAAA
TCGCCGGCGGATGATGAGTACGATTATGATCCGCGCTATGGTAACAAAAA
AAGGCGCAAGCGGCGACCAGGCAAGCGAGGTGGAGATTCCGGCGGCGGTG
GTGGTGGAGGAGGCGCCGGCGGTGGCGGCAATTCCGGCGGTAGCTCCAGC
TCGCGGAGACGCAGTGCAGCGGCCAGGTCGCGTATCACAACGACGGATGC
GGCGCTGGACGCATCGCTGGAGGCCATTGAATCTGGCGAGAGTGTGCCAG
GCAGCAATGGAGGACCAATCTCCAGCGGAGGCATCCTAAGCGGCAGCCTG
GGAGCAGGCTTAGCGGGAGTTTCGGGATCCGGCGGCGGAGGAGGAGCATC
GGGTGCTTCGGCCAACAGCCGCAGATCGCGGGGAGCTGGAACACGTGGCA
GGCGACGAGCCAAGGGGCCAAATAGCGCCGTTGGAGCGTCATGCGATCCG
ACAAGTCCCGGCATGGTCATCGAGCCACCATCCTTCGAGAGTGCCGCTGC
TGCGGTGGGCGTGGTCGAGGACGCGAACGCCCATCTGCGCAACTATCGGA
AGTATCTGTAACCGCTCTATCAGCAACTAACTGGACGTGTAATCAATCAA
AGCCTTGTTTTTCGCAATGTTTTCTCGCCTATTGAATCGACCTACTTTTT
CGCACATAATTTAAATATAGTTTTTAAGCCTTAGTTGATCACTGTTTGTT
GCCCCCCTCCGACAAAAGGATAAAAGCCAAGCAAGAAATGAAAGAAAGGA
AACAAATACATTGTGGACCAGGGACAGAAACAGGATTAGAATCAGGATAA
CGATCAGAACCGCGCACCAGGCCGTAGCCAATACAATTCCAATGTTTCGC
CTCTCTTAACTTTACGTTCCCATAGCCAATTGATTGTTGTTTTTTAAACT
AGCAATGGACTGGTGAACTTCTACTATAGGATAACTTGAGCGGAAACTTA
TGGATGTAGCAAATATTCTTCGAGCAATTTTGTAATGTAGGAAACCCTTT
AGGCCATCAATTATTAACGTTGTATAAGTTAGACAATGAATTTAAAAAGA
ACCTTTTTCGTCATCGTTAGGCAATTCGTAATCAATTATTTTCGGGCATC
ATCTATGCCATAAGTGAAACAGCACAATTTGAATTATATATAGTTTTGCA
ATACACGACCATATTTCACATCTGGTTTCCGAAGTTTTGCTTAGAGCAGT
TCGCCAGACCATTGCATTATATTGTACATTATATATATGGGTGTACAGAC
ATTATATACATATATATATATATATACATACTTGCATGCATTGTATTTGC
GACTCTACTTAAGGCAAGTCCACCTTTTGGACTGGCTCTCCACCTAATCG
CAATCTCTCGGTTTCTGTTGCTGCATGTTCTTAATACTATTTCACCTAGC
TCCCCACCCCTCCCCACATATTATATTCAATTTTTTTTATTTAACCAAAA
TTTTAGTTAAAAAAGAGACAATTCAGATTGTAATCTATTTAGGCAAGTGG
TAGGGTATCTCTAGCATTAGAAGAAGCTAAAAGTAAAAACAATTTCGTAA
AACCAAAATTTTTTCTCTAGGATCATAATTATTAAGCTGAGCTAAAAACG
AAAACAAATTTTAACTAACTAAGAAGGGACAAAATTGAAATAAGATCAAA
AAAGGAAAACATGTACATTTTGGAAGAAAAATCAAAGTCCACAAAATTTT
AACGAATGAGAGGCAAAAAATCAGACAAAAATGAACCACAAGAGAATGAA
AAAAAAAAACAAAAATGGAAATAGGTTTCTAAGATGTTTTAATATATTTT
GTAATAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

SD08423.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RB 3116 tth-RB 209..3116 1..2910 14375 99.6 Plus
tth.a 2164 tth.a 22..2164 704..2848 10580 99.6 Plus
CG11177-RA 1001 CG11177-RA 963..1001 2910..2872 195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13503929..13506160 2908..675 11015 99.6 Minus
chrX 22417052 chrX 13506412..13507090 679..1 3365 99.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 1287 CG12175-PC 1..1287 375..1661 6375 99.7 Plus
tth-RB 1287 CG12175-PB 1..1287 375..1661 6375 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:52:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
tth-RC 3138 CG12175-RC 233..3138 1..2908 14355 99.7 Plus
tth-RB 2955 CG12175-RB 50..2955 1..2908 14355 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
tth-PC 428 CG12175-PC 1..428 375..1658 1254 100 Plus
tth-PB 428 CG12175-PB 1..428 375..1658 1254 100 Plus
d4-PC 495 CG2682-PC 12..208 399..1139 331 35.7 Plus
d4-PD 496 CG2682-PD 12..208 399..1139 331 35.7 Plus
d4-PA 497 CG2682-PA 12..208 399..1139 331 35.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13613191..13615424 2910..675 11025 99.6 Minus
X 23542271 X 13615676..13616354 679..1 3365 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13621289..13623522 2910..675 11035 99.6 Minus
X 23527363 X 13623774..13624452 679..1 3365 99.7 Minus
Blast to na_te.dros performed 2014-11-27 04:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Doc 4725 Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). 2003..2090 2605..2689 117 62.5 Plus

SD08423.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:08:28 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13506412..13507090 1..679 94   Minus
chrX 13505646..13506155 680..1189 92 <- Minus
chrX 13503929..13505590 1245..2908 97 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:28 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 375..1661 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:49 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 375..1661 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:11:52 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 375..1661 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:55 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 375..1661 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:08:28 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..1287 375..1661 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:33 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..2906 1..2908 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:49 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..2906 1..2908 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:11:52 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 50..2955 1..2908 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:56 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 1..2906 1..2908 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:08:28 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
tth-RB 50..2955 1..2908 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:08:28 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
X 13615676..13616354 1..679 99   Minus
X 13613193..13615419 680..2908 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:11:52 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13509709..13510387 1..679 99   Minus
arm_X 13507226..13509452 680..2908 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:36 Download gff for SD08423.complete
Subject Subject Range Query Range Percent Splice Strand
X 13623774..13624452 1..679 99   Minus
X 13621291..13623517 680..2908 99 <- Minus

SD08423.pep Sequence

Translation from 374 to 1660

> SD08423.pep
MSSAVNIQIVSMPNLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLP
FLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKM
YSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSL
TLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKD
SQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYD
YDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGNSGGSSSSRRRSAAA
RSRITTTDAALDASLEAIESGESVPGSNGGPISSGGILSGSLGAGLAGVS
GSGGGGGASGASANSRRSRGAGTRGRRRAKGPNSAVGASCDPTSPGMVIE
PPSFESAAAAVGVVEDANAHLRNYRKYL*

SD08423.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21813-PA 441 GF21813-PA 1..441 1..428 1274 74 Plus
Dana\GF11022-PA 812 GF11022-PA 12..101 9..97 351 65.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19497-PA 430 GG19497-PA 1..430 1..428 1578 96.3 Plus
Dere\GG10866-PA 497 GG10866-PA 12..184 9..231 344 37.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17804-PA 423 GH17804-PA 1..423 1..428 1151 59.5 Plus
Dgri\GH21439-PA 504 GH21439-PA 2..95 4..97 369 64.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
tth-PC 428 CG12175-PC 1..428 1..428 2201 100 Plus
tth-PB 428 CG12175-PB 1..428 1..428 2201 100 Plus
d4-PA 497 CG2682-PA 12..275 9..317 398 34.9 Plus
d4-PD 496 CG2682-PD 12..333 9..359 397 32.4 Plus
d4-PC 495 CG2682-PC 12..332 9..359 392 32 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15144-PA 409 GI15144-PA 1..409 1..428 1134 62.8 Plus
Dmoj\GI20660-PA 492 GI20660-PA 2..95 4..97 367 64.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22648-PA 433 GL22648-PA 1..318 1..324 1112 81 Plus
Dper\GL11042-PA 567 GL11042-PA 61..161 1..97 350 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11454-PA 433 GA11454-PA 1..318 1..324 1113 81 Plus
Dpse\GA15428-PA 507 GA15428-PA 1..101 1..97 351 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17603-PA 428 GM17603-PA 1..428 1..428 2190 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19004-PA 404 GJ19004-PA 1..404 1..428 1185 63.6 Plus
Dvir\GJ20409-PA 490 GJ20409-PA 2..95 4..97 369 64.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25862-PA 467 GK25862-PA 5..320 2..320 966 76.6 Plus
Dwil\GK10624-PA 515 GK10624-PA 12..101 9..97 346 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16149-PA 430 GE16149-PA 1..430 1..428 1611 97.7 Plus
Dyak\GE11247-PA 497 GE11247-PA 12..184 9..231 350 37.9 Plus

SD08423.hyp Sequence

Translation from 374 to 1660

> SD08423.hyp
MSSAVNIQIVSMPNLAKIESFLKDVSYRETIEYSANFNTRLCSERRHRLP
FLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKM
YSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSL
TLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKD
SQQQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYD
YDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGNSGGSSSSRRRSAAA
RSRITTTDAALDASLEAIESGESVPGSNGGPISSGGILSGSLGAGLAGVS
GSGGGGGASGASANSRRSRGAGTRGRRRAKGPNSAVGASCDPTSPGMVIE
PPSFESAAAAVGVVEDANAHLRNYRKYL*

SD08423.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
tth-PC 428 CG12175-PC 1..428 1..428 2201 100 Plus
tth-PB 428 CG12175-PB 1..428 1..428 2201 100 Plus
d4-PA 497 CG2682-PA 12..275 9..317 398 34.9 Plus
d4-PD 496 CG2682-PD 12..333 9..359 397 32.4 Plus
d4-PC 495 CG2682-PC 12..332 9..359 392 32 Plus