Clone SD11456 Report

Search the DGRC for SD11456

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:114
Well:56
Vector:pOT2
Associated Gene/TranscriptCG9293-RB
Protein status:SD11456.pep: gold
Sequenced Size:1009

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9293-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

SD11456.complete Sequence

1009 bp assembled on 2010-12-02

GenBank Submission: BT125797.1

> SD11456.complete
TTGCTATCGTAAACAGACGCTGGAATTTAGCTTACACACTCCATATTCTT
TGTTAAATCCGATATTTGACACCGAAAATGTCATCGGCTATATACCTAGA
GAACTATTTAGACGGATTGGAAAGTCTGCCAACGGAGCTGGAGAGAAATT
TTAAGCTGATGCGAAAATTAGACGATCGAGCACAAACAGCGATGAAGAGC
ATCGATAGCCATGCCAAGGACTTTATGCGCAAGCTGGGCGAGAACGGGGC
CATGAGCGAGGATGAGAGGAGGGAGCGCCAGGAGGATATCAAGGCACTGT
TCGGAAAGGCCAAGGAGTACAGCGACGACAAGGTGCAGCTGGCCATTCAG
ACCTACGAACTAGTGGACAAGCAGATACGGCGACTGGACAACGATTTAGC
ACGCTTCGAGGGTGAGATTCAGGAGAAGGCCTCATCCACGCGTGCCAAAT
CCGAGGAAGTGGTGGCCAAGAAAGGTCGCAAAAAAACCAAGGACAGCAAG
ACGACGGGCAAAAAGAAAAAGTCCGCATCCTCGGATGAGGAAACTGGGCG
CGGCAACAACCAATCTAACGCCAATTCCAGTGTCAATTCGAGCAGCAATG
CCGGGCAAGGTAGCAAAAAGAAAAAGTCCAAGAAAACCGTCGAGGTTGAT
GACTCTGAGAAGGAATCGTGCCACACGGCCGCCACTCATCCCAGCGACGT
TATGGACATGCCCGTCGATCCCAATGAGCCCACATATTGCCTATGCCACC
AGGTGTCCTATGGAGAGATGATTGGCTGCGACAATCCCGACTGTCCCATC
GAGTGGTTTCACTTCGCTTGTGTTGGCCTCACCACAAAGCCAAAGGGCAA
GTGGTTCTGTCCCAAGTGCACGCAGGACAGAAAGAAGAAATAGATGCAAT
CCTTTATGATTACTTAGAATACTACTTTAGATTAAGCACAAAATTACCTA
TTTAAATAAAGCCACGGCTACTATAACTTCAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

SD11456.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13385429..13385786 471..114 1790 100 Minus
chr2L 23010047 chr2L 13384520..13384708 980..792 930 99.5 Minus
chr2L 23010047 chr2L 13384771..13384931 791..631 805 100 Minus
chr2L 23010047 chr2L 13385202..13385362 632..472 805 100 Minus
chr2L 23010047 chr2L 13385848..13385962 115..1 575 100 Minus
chrX 22417052 chrX 18540031..18540186 871..716 225 76.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-RB 816 CG9293-PB 1..816 78..893 4065 99.9 Plus
CG9293-RA 858 CG9293-PA 1..555 78..632 2775 100 Plus
CG9293-RA 858 CG9293-PA 595..858 630..893 1305 99.6 Plus
Ing3-RA 2061 CG6632-PA 1869..2024 716..871 225 76.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-RB 1002 CG9293-RB 23..1002 1..980 4885 99.9 Plus
CG9293-RA 1044 CG9293-RA 23..654 1..632 3160 100 Plus
CG9293-RA 1044 CG9293-RA 694..1044 630..980 1740 99.7 Plus
Ing3-RA 2298 CG6632-RA 1997..2152 716..871 225 76.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-PB 271 CG9293-PB 1..271 78..890 1121 100 Plus
CG9293-PA 285 CG9293-PA 1..285 78..890 1096 87 Plus
Ing3-PA 686 CG6632-PA 624..681 717..890 256 63.8 Plus
CG7379-PA 433 CG7379-PA 353..408 714..881 255 69.6 Plus
Ing3-PA 686 CG6632-PA 2..111 90..422 174 36 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 735..869 163 55.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13386757..13387114 471..114 1790 100 Minus
2L 23513712 2L 13385847..13386036 981..792 935 99.5 Minus
2L 23513712 2L 13386099..13386259 791..631 805 100 Minus
2L 23513712 2L 13386530..13386690 632..472 805 100 Minus
2L 23513712 2L 13387176..13387290 115..1 575 100 Minus
X 23542271 X 18650864..18651019 871..716 225 76.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13386757..13387114 471..114 1790 100 Minus
2L 23513712 2L 13385847..13386036 981..792 935 99.4 Minus
2L 23513712 2L 13386530..13386690 632..472 805 100 Minus
2L 23513712 2L 13386099..13386259 791..631 805 100 Minus
2L 23513712 2L 13387176..13387290 115..1 575 100 Minus
X 23527363 X 18658962..18659089 871..744 220 78.1 Minus
Blast to na_te.dros performed on 2014-11-27 16:29:48 has no hits.

SD11456.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:52:11 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13385849..13385962 1..114 100   Minus
chr2L 13385429..13385785 115..471 100 <- Minus
chr2L 13385202..13385362 472..632 100 <- Minus
chr2L 13384771..13384929 633..791 100 <- Minus
chr2L 13384520..13384708 792..980 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:28:56 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 1..816 78..893 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:42:22 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 1..816 78..893 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:37 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 1..816 78..893 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:11 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 1..816 78..893 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:28:56 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 10..989 1..980 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:42:21 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 10..989 1..980 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:37 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 23..1002 1..980 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:11 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 23..1002 1..980 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:52:11 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13387177..13387290 1..114 100   Minus
2L 13386757..13387113 115..471 100 <- Minus
2L 13386530..13386690 472..632 100 <- Minus
2L 13386099..13386257 633..791 100 <- Minus
2L 13385848..13386036 792..980 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:37 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13387177..13387290 1..114 100   Minus
arm_2L 13386757..13387113 115..471 100 <- Minus
arm_2L 13386530..13386690 472..632 100 <- Minus
arm_2L 13386099..13386257 633..791 100 <- Minus
arm_2L 13385848..13386036 792..980 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:45:54 Download gff for SD11456.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13387177..13387290 1..114 100   Minus
2L 13386757..13387113 115..471 100 <- Minus
2L 13386530..13386690 472..632 100 <- Minus
2L 13386099..13386257 633..791 100 <- Minus
2L 13385848..13386036 792..980 99 <- Minus

SD11456.pep Sequence

Translation from 77 to 892

> SD11456.pep
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFM
RKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI
RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKKKSA
SSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKKTVEVDDSEKESCHT
AATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVG
LTTKPKGKWFCPKCTQDRKKK*

SD11456.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21663-PA 271 GF21663-PA 1..271 1..271 1241 91.9 Plus
Dana\GF18170-PA 441 GF18170-PA 361..416 213..268 275 69.6 Plus
Dana\GF22402-PA 723 GF22402-PA 661..718 214..271 271 63.8 Plus
Dana\GF22402-PA 723 GF22402-PA 2..160 5..170 181 31.3 Plus
Dana\GF11347-PA 2234 GF11347-PA 2179..2223 220..264 173 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10204-PA 271 GG10204-PA 1..271 1..271 1441 98.9 Plus
Dere\GG16752-PA 437 GG16752-PA 357..412 213..268 275 69.6 Plus
Dere\GG18104-PA 676 GG18104-PA 614..671 214..271 270 63.8 Plus
Dere\GG18104-PA 676 GG18104-PA 2..174 5..184 195 31.1 Plus
Dere\GG21797-PA 2160 GG21797-PA 2101..2145 220..264 171 55.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13451-PA 275 GH13451-PA 1..275 1..271 1268 90.5 Plus
Dgri\GH12807-PA 130 GH12807-PA 68..125 214..271 252 63.8 Plus
Dgri\GH15818-PA 448 GH15818-PA 374..423 219..268 244 68 Plus
Dgri\GH20921-PA 2595 GH20921-PA 2535..2579 220..264 174 55.6 Plus
Dgri\GH12806-PA 570 GH12806-PA 2..161 5..176 171 30.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-PB 271 CG9293-PB 1..271 1..271 1422 100 Plus
CG9293-PA 285 CG9293-PA 1..285 1..271 1397 95.1 Plus
CG7379-PA 433 CG7379-PA 223..408 112..268 284 34.2 Plus
Ing3-PA 686 CG6632-PA 624..681 214..271 256 63.8 Plus
Ing3-PA 686 CG6632-PA 2..169 5..179 198 30.9 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 220..264 163 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14043-PA 288 GI14043-PA 1..288 1..271 1266 85.8 Plus
Dmoj\GI15078-PA 679 GI15078-PA 617..674 214..271 268 63.8 Plus
Dmoj\GI17821-PA 417 GI17821-PA 343..392 219..268 243 70 Plus
Dmoj\GI15078-PA 679 GI15078-PA 2..170 5..173 184 28.2 Plus
Dmoj\GI18359-PA 2388 GI18359-PA 2329..2373 220..264 172 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25709-PA 193 GL25709-PA 1..181 1..179 822 90.1 Plus
Dper\GL27018-PA 728 GL27018-PA 666..723 214..271 276 65.5 Plus
Dper\GL27018-PA 728 GL27018-PA 2..111 5..115 177 36 Plus
Dper\GL11465-PA 2492 GL11465-PA 2433..2477 220..264 171 53.3 Plus
Dper\GL20470-PA 63 GL20470-PA 1..38 231..268 167 71.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21675-PA 273 GA21675-PA 1..273 1..271 1307 92.3 Plus
Dpse\GA22529-PA 273 GA22529-PA 1..273 1..271 1303 91.9 Plus
Dpse\GA22347-PA 737 GA22347-PA 675..732 214..271 275 65.5 Plus
Dpse\GA20308-PA 445 GA20308-PA 365..420 213..268 272 69.6 Plus
Dpse\GA22347-PA 737 GA22347-PA 2..111 5..115 176 36 Plus
Dpse\GA18514-PA 2497 GA18514-PA 2438..2482 220..264 171 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25576-PA 271 GM25576-PA 1..271 1..271 1442 99.3 Plus
Dsec\GM15338-PA 433 GM15338-PA 353..408 213..268 275 69.6 Plus
Dsec\GM22794-PA 688 GM22794-PA 626..683 214..271 271 63.8 Plus
Dsec\GM22794-PA 688 GM22794-PA 2..174 5..184 192 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22064-PA 253 GD22064-PA 1..253 1..271 1100 92.6 Plus
Dsim\GD24472-PA 288 GD24472-PA 2..283 5..271 435 33.9 Plus
Dsim\GD20212-PA 433 GD20212-PA 353..408 213..268 275 69.6 Plus
Dsim\GD11289-PA 2160 GD11289-PA 2101..2145 220..264 172 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18259-PA 288 GJ18259-PA 1..288 1..271 1296 86.5 Plus
Dvir\GJ18885-PA 663 GJ18885-PA 601..658 214..271 269 63.8 Plus
Dvir\GJ17317-PA 419 GJ17317-PA 345..394 219..268 243 70 Plus
Dvir\GJ18885-PA 663 GJ18885-PA 2..111 5..115 180 34.2 Plus
Dvir\GJ21428-PA 2481 GJ21428-PA 2422..2466 220..264 174 55.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15283-PA 279 GK15283-PA 1..279 1..271 1178 90 Plus
Dwil\GK10188-PA 774 GK10188-PA 712..769 214..271 267 63.8 Plus
Dwil\GK22501-PA 433 GK22501-PA 359..408 219..268 247 70 Plus
Dwil\GK10188-PA 774 GK10188-PA 2..111 5..115 178 34.2 Plus
Dwil\GK21900-PA 2122 GK21900-PA 2063..2107 220..264 171 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11644-PA 271 GE11644-PA 1..271 1..271 1438 98.9 Plus
Dyak\GE25248-PA 438 GE25248-PA 358..413 213..268 277 69.6 Plus
Dyak\GE15505-PA 679 GE15505-PA 617..674 214..271 265 62.1 Plus
Dyak\GE15505-PA 679 GE15505-PA 2..174 5..184 181 29.7 Plus
Dyak\GE11872-PA 2159 GE11872-PA 2100..2144 220..264 171 55.6 Plus

SD11456.hyp Sequence

Translation from 77 to 892

> SD11456.hyp
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFM
RKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI
RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKKKSA
SSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKKTVEVDDSEKESCHT
AATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVG
LTTKPKGKWFCPKCTQDRKKK*

SD11456.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-PB 271 CG9293-PB 1..271 1..271 1422 100 Plus
CG9293-PA 285 CG9293-PA 1..285 1..271 1397 95.1 Plus
CG7379-PA 433 CG7379-PA 223..408 112..268 284 34.2 Plus
Ing3-PA 686 CG6632-PA 624..681 214..271 256 63.8 Plus
Ing3-PA 686 CG6632-PA 2..169 5..179 198 30.9 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 220..264 163 55.6 Plus