Clone SD15945 Report

Search the DGRC for SD15945

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:159
Well:45
Vector:pOT2
Associated Gene/TranscriptRpp20-RA
Protein status:SD15945.pep: gold
Sequenced Size:1261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rpp20-RA 2009-01-27 EST screening

Clone Sequence Records

SD15945.complete Sequence

1261 bp assembled on 2009-03-13

GenBank Submission: BT072833.1

> SD15945.complete
CGATTCGGAATGGAGTCGCGAGTCCGAAACTGCGACACGCGCAGGTAAAT
GGAAAACACAAGTCGCCTCCTCCGCCGCTGATGATGGGAAGCAATTATCC
CGAGCACGGGACCAAGCCGAGATCCGCCAAATACCACAAACAACAGAACC
ACCGAGTGGTGCGCAAGCAGCCGCCGCGTCCCGCTGTTAGCGACCGCCAC
AACATCTACATCACCAGCAAGACAGACTTTAAGGCCCAGCAGCGCCGCTG
CGAGGAGCTGATTAACTCCGGCGCCCACGAGATCTTTCTGCATTGCATGG
GCTTCTCCGTAACCCGCGGCCTCAATATCGCCCTACGCCTCGTCCAGAAT
TCTGACGGCGCCCTTAGCTACGCCATCAACACCTCCACCGTTCAGCTGGT
GGACGAACTGCACCCGCTGTGCGATGCCGAGGACATAACCTTCCGCCAGC
GCAACAACTCGGCCCTGCACATCAAGATCCTCAATAACAGTCTCTTCGAC
ATCGCCGTGCCGCAACCGTCGCAGTCCCAGACGCAAGCCCAGTCCCTGGG
CCAGTTCCGAGGCAAGGCGAAGGCCAGGCAGTAGCATGTTCAAACTCTCG
GAGCTGGTGCGCTGGCTGGGGCTCACCGAGTTCGAGATTCTGGTCAATCT
GTGCGGCCTGCTGGTGTTCACCATCACGCTGACCGTCAAGCTCCATCTGC
AGGCCAGGGCCGGACCCGGTGGCATACTCCCGGAGCCCATGGGCGACTGG
TTCACCGTCTTCAGCCCCCTGTTCTTCATCGACATCTGCAACGCGTACTT
TTGCGTCATTGTGGGCATCCGCATGTACCTGGACTCTAACAACAAGCGCA
AAGCCCTGCATCGCTTCATGTGGAGCACGTATTTCCTGGTGCTCATCGCC
ATCTTCAAGTACCTGCTCTGCCTGAAGCTATCCAGCAAGACGGGCCTCGA
GTATTCGGAGGTCTTCTCGCCGATCTTCGTTCTGTTGCAGCTCGTGGCTG
TGCGCGCCTGCCAGTTGCCCAACTCCATCTAAACCATAGACGTAGTATAG
CCCTAGTTCCGTATTATACATATATGTAACTATTCTGAAAGCCTTTAAAT
CATTGGATTGGTAGTTATCTGTATACGCAATGTGGTACAATAATTTTTAA
GCGGTACGAAATTTATCTTTCTGGATATAGCATATCTAATATATACGAAT
TATATCTGATCTGATTCGGTATGAAGGACATACATACATAAAAAAAAAAA
AAAAAAAAAAA

SD15945.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RA 1242 Rpp20-RA 17..1242 1..1226 6130 100 Plus
CG33932-RA 1242 CG33932-RA 17..1242 1..1226 6130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19633464..19634471 232..1239 5040 100 Plus
chrX 22417052 chrX 19633160..19633394 1..235 1175 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RB 504 CG33931-PB 1..504 81..584 2520 100 Plus
Rpp20-RA 504 CG33931-PA 1..504 81..584 2520 100 Plus
CG33932-RB 447 CG33932-PB 1..447 586..1032 2235 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RB 1395 CG33931-RB 19..1257 1..1239 6195 100 Plus
CG33932-RB 1395 CG33932-RB 19..1257 1..1239 6195 100 Plus
Rpp20-RA 1244 CG33931-RA 19..1244 1..1226 6130 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-PB 167 CG33931-PB 1..167 81..581 797 100 Plus
Rpp20-PA 167 CG33931-PA 1..167 81..581 797 100 Plus
CG33932-PB 148 CG33932-PB 1..148 586..1029 770 100 Plus
CG33932-PA 148 CG33932-PA 1..148 586..1029 770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19744753..19745761 232..1240 5045 100 Plus
X 23542271 X 19744449..19744683 1..235 1175 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19752851..19753859 232..1240 5045 100 Plus
X 23527363 X 19752547..19752781 1..235 1175 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:17:47 has no hits.

SD15945.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:50 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19633472..19634471 240..1239 100   Plus
chrX 19633160..19633396 1..239 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:09 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 81..584 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:49:18 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 81..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:35 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 81..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:50 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 81..584 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-13 17:08:21 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 17..1242 1..1226 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:49:18 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
CG33932-RA 17..1242 1..1226 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:35 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 19..1244 1..1226 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:50 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
CG33932-RB 19..1257 1..1239 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:50 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
X 19744761..19745760 240..1239 100   Plus
X 19744449..19744685 1..239 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:35 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19638794..19639793 240..1239 100   Plus
arm_X 19638482..19638718 1..239 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:35:01 Download gff for SD15945.complete
Subject Subject Range Query Range Percent Splice Strand
X 19752859..19753858 240..1239 100   Plus
X 19752547..19752783 1..239 98 -> Plus

SD15945.pep Sequence

Translation from 2 to 583

> SD15945.pep
IRNGVASPKLRHAQVNGKHKSPPPPLMMGSNYPEHGTKPRSAKYHKQQNH
RVVRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELINSGAHEIFLHCMG
FSVTRGLNIALRLVQNSDGALSYAINTSTVQLVDELHPLCDAEDITFRQR
NNSALHIKILNNSLFDIAVPQPSQSQTQAQSLGQFRGKAKARQ*

SD15945.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20215-PA 168 GF20215-PA 1..168 28..193 545 68 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19253-PA 167 GG19253-PA 1..167 27..193 742 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17693-PA 193 GH17693-PA 1..152 28..174 580 71.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-PB 167 CG33931-PB 1..167 27..193 869 100 Plus
Rpp20-PA 167 CG33931-PA 1..167 27..193 869 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16100-PA 163 GI16100-PA 1..163 28..190 563 64 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15016-PA 192 GL15016-PA 1..155 28..174 552 69.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22553-PA 192 GA22553-PA 1..155 28..174 561 69.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22990-PA 166 GM22990-PA 1..166 28..193 848 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17463-PA 166 GD17463-PA 1..166 28..193 845 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15750-PA 189 GJ15750-PA 1..151 28..174 558 71.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16388-PA 195 GK16388-PA 24..153 48..174 491 70 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15872-PA 166 GE15872-PA 1..166 28..193 825 91.6 Plus

SD15945.hyp Sequence

Translation from 585 to 1031

> SD15945.hyp
MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPE
PMGDWFTVFSPLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYF
LVLIAIFKYLLCLKLSSKTGLEYSEVFSPIFVLLQLVAVRACQLPNSI*

SD15945.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33932-PB 148 CG33932-PB 1..148 1..148 770 100 Plus
CG33932-PA 148 CG33932-PA 1..148 1..148 770 100 Plus