Clone TA01396 Report

Search the DGRC for TA01396

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:13
Well:96
Vector:pOTB7_DraIII
Associated Gene/TranscriptMal-A4-RA
Protein status:TA01396.pep: gold
Sequenced Size:1816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8693 2008-04-29 Release 5.5 accounting
CG8693 2008-04-29 Picked prior to 5.5
CG8693 2008-08-15 Release 5.9 accounting
CG8693 2008-12-18 5.12 accounting

Clone Sequence Records

TA01396.complete Sequence

1816 bp assembled on 2007-11-15

GenBank Submission: BT031306

> TA01396.complete
CAGTTAGCAATGACCACTTGGACTAGCTTGTTCCTGCTTTTGGGCCTTGG
CCTTCTGGCTGTCGATGCCGCGGCGCCCTGGTGGAAGACCGCTTCCTTCT
ACCAGATCTACCCGCGCTCCTTCAAAGACAGTGACGGAAATGGAGTCGGA
GACTTAAACGGGGTGACCGAGAAGCTGGAGTACCTTAAGGAGATCGGCGT
GACCGCCACCTGGCTGTCTCCTTTTCTGAAATCCCCGATGGCAGACTTTG
GCTATGACATTTCCGATTTCAAGGCGGTCGACCCTCTTTTCGGAACGATG
GAGGACTTCGAGAATATGGTCTCCCGCGCCAAGGAGCTGGGTGTCAAGAT
TATTCTCGACTTCGTGCCCAATCATTCCAGTGATGAGTGCGATTGGTTCC
TTCGTTCGGCTGCCGGCGAGGAGGAGTACAAGGACTACTACATGTGGCAC
CCGGGATTCCTCGATGAGGACGGAACCCGTCGCCCGCCTACCAACTGGGT
GAGCGTGTTCCGCGGCAGCGCATGGGAGTGGCACGAGGGTCGCCAGGAGT
ACTATCTTCATCAATTCCACAAGAAGCAACCGGACTTCAACTTCCGTAAT
CCCGTGGTGCGCGAGGAGATGAACAACGTGCTGCGATTCTGGCTGGAAAA
GGGCGTCGATGGTTTCCGCGTGGATGCCATCTACCACGCCTTTGAGATTG
AGGCCGACGAGAACGGAAACTATCCGGATGAGCCCCGCAACGATTGGACC
AACGATCCAGATGAGTACGGATACACCCACAAGATCTACACTGTGGATCA
GCCAGAGACCCCGCACTTGGTATACGAATGGCGCCAAATTCTTGAGCAGT
TCCAGGCTGACAATGGCGGTGATGAGCGCATATTGATGGTGGAGACCTGG
TCCCCCATTGAAATCGTAATGCATTACTATGGCAACGAAACCGCCGATGG
AGCCCAGATACCGTTCAATTTCCAGCTGATAAGTAATCTGCACTACGATT
CCGATGCCTATCATTACGAGTACTTGATTAACAACTGGCTTAATCTGATG
CCAGAGGGGAAGAGCGCCAACTGGGTGATCGGTAACCATGACAAGAACCG
TGTGGGCTCTCGATTCGGAGCCGATCGAGTTGACCTCTTCAACATCCTGC
TTCTCACTCTGCCCGGCTGCAGCATCACGTACCAGGGCGAGGAGCTGGGC
ATGCTCGACGGATATGTGTCCTGGGAGGACACCGTGGATCCGCAAGCCTG
CAACGGCTACGAGGCAAACTACATGGATAACTCCCGCGACCCAGCCCGCA
CTCCGATGCACTGGTCGGATGAGACGATGGCTGGATTCACCACTGGCAAC
AGCACCTGGCTGCCGGTATCCACGGATTATCGCCAGAGGAACGTGAAAAC
CGAGCGCGGCGTGTCCCTGAGCCACCTGAACGTGTTCAAGCGTCTGCAGC
AGCTCCGTCAGGAGCCCAGCATTGAAGAAGGATCCGCCGAGGTCAAGGCT
GTTAGCAACTACGTCCTGGCCGTCAAGCGCCACCTGAGCGGCGACTTCGT
CTACATCTCTCTCTTCAACATCTTCGACTCCATCGAGAATGTGAACCTAT
CCAGTGTGTTTGGCAGCCTGCCCGCCAAGTTCCAGTACGCCCTGGTCACC
GAGAAGTCCATCAAGAAGGTCGGCGACCAGGTGTCCGCCGGCAGCGTCAC
CCTCATGCCCCACGAGTCCATTGTGCTGCGTTCCACAACAACAGCTTAGT
TTATTCCCCTCGTGATAAATTAAACCATTAAAAAGCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

TA01396.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8693-RA 1902 CG8693-RA 53..1839 1..1787 8935 100 Plus
CG30359.a 1968 CG30359.a 604..704 484..584 190 79.2 Plus
CG30359-RA 2098 CG30359-RA 670..770 484..584 190 79.2 Plus
CG30359.a 1968 CG30359.a 1275..1323 1155..1203 155 87.7 Plus
CG30359-RA 2098 CG30359-RA 1341..1389 1155..1203 155 87.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4346343..4347163 1..821 4105 100 Plus
chr2R 21145070 chr2R 4347622..4348074 1077..1529 2265 100 Plus
chr2R 21145070 chr2R 4348155..4348412 1529..1786 1290 100 Plus
chr2R 21145070 chr2R 4347337..4347536 878..1077 1000 100 Plus
chr2R 21145070 chr2R 4344885..4345046 450..289 300 79 Minus
chr2R 21145070 chr2R 4347225..4347281 822..878 285 100 Plus
chr2R 21145070 chr2R 4359606..4359797 78..269 240 75 Plus
chr2R 21145070 chr2R 4339047..4339329 381..99 230 72.1 Minus
chr2R 21145070 chr2R 4350661..4351061 181..584 230 71 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-RA 1740 CG8693-PA 1..1740 10..1749 8700 100 Plus
Mal-A3-RA 1725 CG8695-PA 277..438 289..450 300 79 Plus
Mal-A5-RC 1836 CG30359-PC 130..632 79..584 275 70.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-RA 1786 CG8693-RA 1..1786 1..1786 8930 100 Plus
Mal-A3-RA 1795 CG8695-RA 313..474 289..450 300 79 Plus
Mal-A5-RC 1988 CG30359-RC 222..724 79..584 275 70.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-PA 579 CG8693-PA 1..579 10..1746 3081 100 Plus
Mal-A3-PA 574 CG8695-PA 19..571 67..1728 1919 60.6 Plus
Mal-A5-PA 630 CG30359-PA 44..598 79..1743 1899 61 Plus
Mal-A5-PC 611 CG30359-PC 44..579 79..1743 1816 59 Plus
Mal-A5-PB 534 CG30359-PB 1..502 238..1743 1660 59.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8458815..8459635 1..821 4105 100 Plus
2R 25286936 2R 8460094..8460546 1077..1529 2265 100 Plus
2R 25286936 2R 8460627..8460885 1529..1787 1295 100 Plus
2R 25286936 2R 8459809..8460008 878..1077 1000 100 Plus
2R 25286936 2R 8457357..8457518 450..289 300 79 Minus
2R 25286936 2R 8459697..8459753 822..878 285 100 Plus
2R 25286936 2R 8472078..8472269 78..269 240 75 Plus
2R 25286936 2R 8451519..8451801 381..99 230 72.1 Minus
2R 25286936 2R 8463133..8463533 181..584 230 71 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8460014..8460834 1..821 4105 100 Plus
2R 25260384 2R 8461293..8461745 1077..1529 2265 100 Plus
2R 25260384 2R 8461826..8462084 1529..1787 1295 100 Plus
2R 25260384 2R 8461008..8461207 878..1077 1000 100 Plus
2R 25260384 2R 8460896..8460952 822..878 285 100 Plus
2R 25260384 2R 8458556..8458681 450..325 285 81.7 Minus
2R 25260384 2R 8464632..8464732 484..584 190 79.2 Plus
2R 25260384 2R 8465421..8465469 1155..1203 155 87.7 Plus
2R 25260384 2R 8473277..8473328 78..129 155 86.5 Plus
2R 25260384 2R 8473374..8473468 175..269 145 76.8 Plus
Blast to na_te.dros performed on 2014-11-27 10:18:13 has no hits.

TA01396.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:40:11 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4348156..4348412 1530..1786 100   Plus
chr2R 4347623..4348074 1078..1529 100 -> Plus
chr2R 4347338..4347536 879..1077 100 -> Plus
chr2R 4347225..4347281 822..878 100 -> Plus
chr2R 4346343..4347163 1..821 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:39 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1740 10..1749 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:31 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1740 10..1749 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:24 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 1..1740 10..1749 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:42 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1740 10..1749 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:11 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 1..1740 10..1749 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:23 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1777 10..1786 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:31 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1777 10..1786 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:24 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 1..1786 1..1786 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:42 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1777 10..1786 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:11 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 1..1786 1..1786 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:40:11 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8460628..8460884 1530..1786 100   Plus
2R 8460095..8460546 1078..1529 100 -> Plus
2R 8459810..8460008 879..1077 100 -> Plus
2R 8459697..8459753 822..878 100 -> Plus
2R 8458815..8459635 1..821 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:24 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4348133..4348389 1530..1786 100   Plus
arm_2R 4347600..4348051 1078..1529 100 -> Plus
arm_2R 4347315..4347513 879..1077 100 -> Plus
arm_2R 4347202..4347258 822..878 100 -> Plus
arm_2R 4346320..4347140 1..821 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:46 Download gff for TA01396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8461827..8462083 1530..1786 100   Plus
2R 8461294..8461745 1078..1529 100 -> Plus
2R 8461009..8461207 879..1077 100 -> Plus
2R 8460896..8460952 822..878 100 -> Plus
2R 8460014..8460834 1..821 100 -> Plus

TA01396.hyp Sequence

Translation from 0 to 1748

> TA01396.hyp
QLAMTTWTSLFLLLGLGLLAVDAAAPWWKTASFYQIYPRSFKDSDGNGVG
DLNGVTEKLEYLKEIGVTATWLSPFLKSPMADFGYDISDFKAVDPLFGTM
EDFENMVSRAKELGVKIILDFVPNHSSDECDWFLRSAAGEEEYKDYYMWH
PGFLDEDGTRRPPTNWVSVFRGSAWEWHEGRQEYYLHQFHKKQPDFNFRN
PVVREEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPDEPRNDWT
NDPDEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETW
SPIEIVMHYYGNETADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLM
PEGKSANWVIGNHDKNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELG
MLDGYVSWEDTVDPQACNGYEANYMDNSRDPARTPMHWSDETMAGFTTGN
STWLPVSTDYRQRNVKTERGVSLSHLNVFKRLQQLRQEPSIEEGSAEVKA
VSNYVLAVKRHLSGDFVYISLFNIFDSIENVNLSSVFGSLPAKFQYALVT
EKSIKKVGDQVSAGSVTLMPHESIVLRSTTTA*

TA01396.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-PA 579 CG8693-PA 1..579 4..582 3137 100 Plus
Mal-A3-PA 574 CG8695-PA 7..571 10..576 1923 60.1 Plus
Mal-A5-PA 630 CG30359-PA 44..598 27..581 1899 61 Plus
Mal-A5-PC 611 CG30359-PC 44..579 27..581 1816 59 Plus
Mal-A5-PB 534 CG30359-PB 1..502 80..581 1660 59.4 Plus

TA01396.pep Sequence

Translation from 9 to 1748

> TA01396.pep
MTTWTSLFLLLGLGLLAVDAAAPWWKTASFYQIYPRSFKDSDGNGVGDLN
GVTEKLEYLKEIGVTATWLSPFLKSPMADFGYDISDFKAVDPLFGTMEDF
ENMVSRAKELGVKIILDFVPNHSSDECDWFLRSAAGEEEYKDYYMWHPGF
LDEDGTRRPPTNWVSVFRGSAWEWHEGRQEYYLHQFHKKQPDFNFRNPVV
REEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPDEPRNDWTNDP
DEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETWSPI
EIVMHYYGNETADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLMPEG
KSANWVIGNHDKNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELGMLD
GYVSWEDTVDPQACNGYEANYMDNSRDPARTPMHWSDETMAGFTTGNSTW
LPVSTDYRQRNVKTERGVSLSHLNVFKRLQQLRQEPSIEEGSAEVKAVSN
YVLAVKRHLSGDFVYISLFNIFDSIENVNLSSVFGSLPAKFQYALVTEKS
IKKVGDQVSAGSVTLMPHESIVLRSTTTA*

TA01396.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Mal-A4-PA 579 GF12361-PA 1..579 1..579 2957 93.6 Plus
Dana\Mal-A3-PA 574 GF12586-PA 23..574 24..576 1919 60.4 Plus
Dana\Mal-A5-PA 630 GF12362-PA 35..598 15..578 1915 60.9 Plus
Dana\Mal-A1-PA 577 GF12587-PA 8..574 10..573 1570 50.5 Plus
Dana\Mal-A6-PA 604 GF12363-PA 46..604 24..576 1544 50.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Mal-A4-PA 579 GG23360-PA 1..579 1..579 2960 95.2 Plus
Dere\Mal-A3-PA 574 GG10640-PA 23..574 24..576 1906 59.9 Plus
Dere\Mal-A5-PA 630 GG23362-PA 33..598 13..578 1896 60.1 Plus
Dere\Mal-A6-PA 600 GG23363-PA 42..600 24..576 1563 50.4 Plus
Dere\Mal-A1-PA 577 GG10641-PA 8..574 10..573 1530 49.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21092-PA 578 GH21092-PA 1..578 1..579 2741 85.8 Plus
Dgri\GH20810-PA 575 GH20810-PA 7..575 6..576 1951 60.4 Plus
Dgri\GH21093-PA 634 GH21093-PA 39..592 19..575 1855 59.7 Plus
Dgri\GH21094-PA 594 GH21094-PA 37..594 24..576 1597 51.5 Plus
Dgri\GH20813-PA 576 GH20813-PA 13..573 15..573 1585 51.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-PA 579 CG8693-PA 1..579 1..579 3137 100 Plus
Mal-A3-PA 574 CG8695-PA 7..571 7..573 1923 60.1 Plus
Mal-A5-PA 630 CG30359-PA 44..598 24..578 1899 61 Plus
Mal-A5-PC 611 CG30359-PC 44..579 24..578 1816 59 Plus
Mal-A5-PB 534 CG30359-PB 1..502 77..578 1660 59.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Mal-A4-PA 578 GI18696-PA 1..577 1..578 2721 84.3 Plus
Dmoj\Mal-A3-PA 574 GI20898-PA 23..574 24..576 1954 60.8 Plus
Dmoj\Mal-A5-PA 626 GI18697-PA 40..593 21..577 1899 60.9 Plus
Dmoj\Mal-A1-PA 577 GI20901-PA 13..535 15..534 1584 53.7 Plus
Dmoj\Mal-A6-PA 598 GI18698-PA 35..598 19..576 1579 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11224-PA 579 GL11224-PA 1..579 1..579 2840 91.2 Plus
Dper\GL10860-PA 577 GL10860-PA 26..577 24..576 1951 61.1 Plus
Dper\GL11225-PA 630 GL11225-PA 40..598 20..578 1933 61.6 Plus
Dper\GL11226-PA 605 GL11226-PA 47..605 24..576 1560 51.1 Plus
Dper\GL10861-PA 579 GL10861-PA 20..575 21..573 1506 50.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Mal-A4-PA 579 GA24650-PA 1..579 1..579 2833 91 Plus
Dpse\Mal-A3-PA 577 GA21264-PA 26..577 24..576 1965 61.3 Plus
Dpse\Mal-A5-PA 630 GA24651-PA 40..598 20..578 1955 62.1 Plus
Dpse\Mal-A6-PA 605 GA15787-PA 47..605 24..576 1568 51.2 Plus
Dpse\Mal-A1-PA 579 GA24513-PA 20..575 21..573 1566 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Mal-A4-PA 579 GM21035-PA 1..579 1..579 2993 97.6 Plus
Dsec\Mal-A5-PA 630 GM21036-PA 44..598 24..578 1909 61.3 Plus
Dsec\Mal-A3-PA 574 GM20685-PA 19..574 20..576 1908 59.4 Plus
Dsec\Mal-A1-PA 577 GM20686-PA 8..574 10..573 1536 50 Plus
Dsec\Mal-A7-PA 599 GM20684-PA 2..596 1..579 1464 46.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10567-PA 630 GD10567-PA 44..598 24..578 1905 61 Plus
Dsim\GD10565-PA 675 GD10565-PA 298..675 202..579 1836 92.3 Plus
Dsim\GD10167-PA 535 GD10167-PA 16..533 35..553 1793 59.9 Plus
Dsim\GD10565-PA 675 GD10565-PA 1..329 97..427 1718 95.5 Plus
Dsim\Mal-A6-PA 601 GD10569-PA 43..601 24..576 1554 50 Plus
Dsim\Mal-A1-PA 577 GD10169-PA 8..574 10..573 1535 49.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Mal-A4-PA 578 GJ21713-PA 1..577 1..578 2772 88.6 Plus
Dvir\Mal-A3-PA 575 GJ20630-PA 2..574 1..575 1941 59.7 Plus
Dvir\Mal-A5-PA 636 GJ21715-PA 44..595 24..578 1894 61.3 Plus
Dvir\Mal-A6-PA 602 GJ21716-PA 39..602 19..576 1566 50.8 Plus
Dvir\Mal-A1-PA 577 GJ20632-PA 12..535 14..534 1559 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21504-PA 579 GK21504-PA 1..579 1..579 2800 87.9 Plus
Dwil\GK21811-PA 578 GK21811-PA 9..578 6..576 1910 57.4 Plus
Dwil\GK21505-PA 632 GK21505-PA 35..595 18..578 1909 60.7 Plus
Dwil\GK21812-PA 579 GK21812-PA 5..537 6..534 1549 51.2 Plus
Dwil\GK21506-PA 598 GK21506-PA 40..597 24..575 1537 50.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Mal-A4-PA 579 GE19202-PA 1..579 1..579 2998 97.6 Plus
Dyak\Mal-A3-PA 574 GE22993-PA 23..574 24..576 1903 59.9 Plus
Dyak\Mal-A5-PA 601 GE19203-PA 36..569 45..578 1758 59.1 Plus
Dyak\Mal-A6-PA 601 GE19204-PA 43..601 24..576 1568 50.5 Plus
Dyak\Mal-A1-PA 577 GE23004-PA 8..574 10..573 1537 49.8 Plus