Clone TA01530 Report

Search the DGRC for TA01530

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:15
Well:30
Vector:pOTB7_DraIII
Associated Gene/Transcriptyellow-g2-RA
Protein status:TA01530.pep: gold
Sequenced Size:1458

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
yellow-g2 2008-04-29 Release 5.5 accounting
yellow-g2 2008-08-15 Release 5.9 accounting
yellow-g2 2008-12-18 5.12 accounting

Clone Sequence Records

TA01530.complete Sequence

1458 bp assembled on 2007-09-19

GenBank Submission: BT031044

> TA01530.complete
AGCAGAACGCGCACGTCGCTGCCGCACCATTAACAATTGCTTCCACGATG
AGACTGCACTTGGCCCTGATCCTTGGATTTTGCCTAGTTGGCTGGGCCCG
CTCGCAGGGCACCAAGTACGGACTGTGGACTCCGGATCGGGCGCACTCCG
ATTCTCAGCCCATCCAGTGGACGGGCGGGCAATTCGAGTTCCCATGCGCC
AGTACCAAGTCGCTCTTCAAGAGCTCCGGAAAGTTTATACCCAAGAATGT
GATTGCCACGCGGGCGCAGCTCATTGGAGACACCATCTATCTGGCTCTGC
CGCGCTACAGGAAGGGAGTTCCGGCCACGCTGGTGAAGACCAGTATCAAG
CCGGGCACCTGCTCCACCACCTTTAAGCCCTATCCCTGCTGGGACCTCCA
GGAGGAGGGCAACTGCAAGGCTCTGCAATCGGTGGTGGATCTGGTGGTAG
ACCAAAACGAGGTGCTCTGGGTCTTGGACACGGGCATAGTGAACACTCTG
GAGACTCCGGTGCGCAAGTGCCCACCAAAAGTGGTGGCCATGTCGGTGAA
GACTGGCAAGGTTCTGAAGACCGTCTCGCTGGAGGGCCTGACTTCCAGCA
ATTCCCGTCTCCAATATCTGGTAGTGGACTATGCTCCGGATGGCGGCTGC
TTTGTCTACGTCAGCGATGCCGCCAATCGGGCCATCATCGTGTACAATCT
CCAGGCGGATCGGGGATTCAGGGTGGTGCTGCCCAAGGCCGTTACCGCCG
GCTGTCGGTCGAGGGATGTCCTCTACATAGCCCTCATCCGCCGGGACTGC
GGCTCAACGGAACTGTACTTCACCTACCTGAGCACCAACAAACTGTTCTC
CCTGAAGTCAGAGTATCTGAGGAGTGGAGTGGCCGATGGACGCATCTTGG
ATCTCGGCAAGAAGCCCAGTCGCATGGTCATCATCGGCACGGACAACGGC
TCGGCGATCTTCTTCCGCAACGAGGGCGACGCGGAGGTGTACCGCTGGGA
CACGAACTCCACATTCGTGGAGGCCAACTTCAAGCCGGTTTACCGCAGTC
AGACCTGCCAGCTGGTGACCCATGCTGTGCCCGATTACAAGCGGAACACG
ATGCGAGTCCTGCAGAGCAATTTTCCGGATTACATGCAGAACCGCGTTGG
ATGCGGAGCCATTCAGCAGCTGGGTCTGATGCAGGGCTGTTGGTAACCAT
GTTAACACCCCATTTTGGCCACCACTCGTCCTCCACAAGCCAATCCGAAT
TGAAAGCTGAAAAACTGAATATGCCATTGCAGTTAGATTGGCAATAACCG
AGAATGGGTCGCTCTTTGGACCCTCGAGTGCTCTTCGTATTTGGTATTGG
TGTTTTGTACATAAACTAACGACTTTGGTCGCTATTGTTGTTATCTAAGC
TAAGCAAATAAACGTTTCATATTCATACAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

TA01530.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-RA 1584 yellow-g2-RA 110..1538 1..1429 7145 100 Plus
nc_10119.a 686 nc_10119.a 255..621 1266..900 1835 100 Minus
yellow-g-RA 1375 yellow-g-RA 466..527 378..439 190 87 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2275987..2276886 1..900 4335 98.8 Plus
chr3L 24539361 chr3L 2276944..2277472 900..1428 2600 99.4 Plus
chr3L 24539361 chr3L 2271702..2271763 439..378 190 87.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-RA 1149 CG13804-PA 1..1149 48..1196 5745 100 Plus
yellow-g-RA 1182 CG5717-PA 361..486 378..503 210 77.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-RA 1431 CG13804-RA 2..1429 1..1428 7140 100 Plus
yellow-g-RA 1344 CG5717-RA 439..564 378..503 210 77.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-PA 382 CG13804-PA 1..382 48..1193 2016 100 Plus
yellow-g-PA 393 CG5717-PA 50..377 165..1154 880 48.8 Plus
yellow-e-PA 530 CG9792-PA 52..329 240..1001 240 29.1 Plus
yellow-h-PA 463 CG1629-PA 78..249 225..725 229 31.4 Plus
y-PA 541 CG3757-PA 22..284 141..872 221 25 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2276551..2277450 1..900 4500 100 Plus
3L 28110227 3L 2277508..2278037 900..1429 2650 100 Plus
3L 28110227 3L 2272270..2272331 439..378 190 87.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2276551..2277450 1..900 4500 100 Plus
3L 28103327 3L 2277508..2278037 900..1429 2650 100 Plus
3L 28103327 3L 2272270..2272331 439..378 190 87 Minus
Blast to na_te.dros performed on 2014-11-27 15:13:30 has no hits.

TA01530.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:25:46 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2276945..2277472 901..1428 99   Plus
chr3L 2275987..2276886 1..900 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:45 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:33 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:14 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:44 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:46 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:27 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 2..1429 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:33 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 2..1429 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:14 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 2..1429 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:44 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 1..1149 48..1196 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:46 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 2..1429 1..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:25:46 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2277509..2278036 901..1428 100   Plus
3L 2276551..2277450 1..900 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:14 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2277509..2278036 901..1428 100   Plus
arm_3L 2276551..2277450 1..900 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:49 Download gff for TA01530.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2277509..2278036 901..1428 100   Plus
3L 2276551..2277450 1..900 100 -> Plus

TA01530.hyp Sequence

Translation from 2 to 1195

> TA01530.hyp
QNAHVAAAPLTIASTMRLHLALILGFCLVGWARSQGTKYGLWTPDRAHSD
SQPIQWTGGQFEFPCASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALP
RYRKGVPATLVKTSIKPGTCSTTFKPYPCWDLQEEGNCKALQSVVDLVVD
QNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVSLEGLTSSN
SRLQYLVVDYAPDGGCFVYVSDAANRAIIVYNLQADRGFRVVLPKAVTAG
CRSRDVLYIALIRRDCGSTELYFTYLSTNKLFSLKSEYLRSGVADGRILD
LGKKPSRMVIIGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFKPVYRSQ
TCQLVTHAVPDYKRNTMRVLQSNFPDYMQNRVGCGAIQQLGLMQGCW*

TA01530.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-PA 382 CG13804-PA 1..382 16..397 2016 100 Plus
yellow-g-PA 393 CG5717-PA 50..377 55..384 880 48.8 Plus
yellow-e-PA 530 CG9792-PA 52..329 80..333 240 29.1 Plus
yellow-h-PA 463 CG1629-PA 78..249 75..241 229 31.4 Plus
y-PA 541 CG3757-PA 22..284 47..290 221 25 Plus

TA01530.pep Sequence

Translation from 47 to 1195

> TA01530.pep
MRLHLALILGFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPC
ASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATLVKTSI
KPGTCSTTFKPYPCWDLQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNT
LETPVRKCPPKVVAMSVKTGKVLKTVSLEGLTSSNSRLQYLVVDYAPDGG
CFVYVSDAANRAIIVYNLQADRGFRVVLPKAVTAGCRSRDVLYIALIRRD
CGSTELYFTYLSTNKLFSLKSEYLRSGVADGRILDLGKKPSRMVIIGTDN
GSAIFFRNEGDAEVYRWDTNSTFVEANFKPVYRSQTCQLVTHAVPDYKRN
TMRVLQSNFPDYMQNRVGCGAIQQLGLMQGCW*

TA01530.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24911-PA 387 GF24911-PA 9..387 5..382 1940 96 Plus
Dana\GF24870-PA 394 GF24870-PA 50..378 39..369 892 48 Plus
Dana\y-PA 546 GF21448-PA 33..286 41..275 236 25.5 Plus
Dana\GF17380-PA 524 GF17380-PA 53..329 66..318 218 26.7 Plus
Dana\GF11856-PA 428 GF11856-PA 35..232 40..226 207 26.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14855-PA 382 GG14855-PA 1..382 1..382 2010 98.2 Plus
Dere\GG14522-PA 393 GG14522-PA 49..377 39..369 896 48.3 Plus
Dere\GG17050-PA 530 GG17050-PA 30..329 40..318 255 28.4 Plus
Dere\GG16380-PA 459 GG16380-PA 38..245 27..226 240 28.4 Plus
Dere\y-PA 541 GG12780-PA 31..284 41..275 234 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16473-PA 386 GH16473-PA 1..386 1..382 1896 91.5 Plus
Dgri\GH15007-PA 395 GH15007-PA 51..379 39..369 890 48 Plus
Dgri\GH23996-PA 455 GH23996-PA 51..244 40..226 237 28.4 Plus
Dgri\GH18542-PA 554 GH18542-PA 33..335 40..321 234 27.1 Plus
Dgri\GH24338-PA 546 GH24338-PA 29..282 41..275 225 27.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-PA 382 CG13804-PA 1..382 1..382 2016 100 Plus
yellow-g-PA 393 CG5717-PA 50..377 40..369 880 48.8 Plus
yellow-e-PA 530 CG9792-PA 52..329 65..318 240 29.1 Plus
yellow-h-PA 463 CG1629-PA 78..249 60..226 229 31.4 Plus
y-PA 541 CG3757-PA 22..284 32..275 221 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12146-PA 387 GI12146-PA 1..387 1..382 1887 91.7 Plus
Dmoj\GI13169-PA 396 GI13169-PA 52..380 39..369 849 47.7 Plus
Dmoj\GI23241-PA 533 GI23241-PA 31..330 40..318 236 27.3 Plus
Dmoj\GI11002-PA 470 GI11002-PA 61..254 40..226 230 30.3 Plus
Dmoj\GI21724-PA 543 GI21724-PA 36..289 41..275 220 26.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24646-PA 375 GL24646-PA 23..375 18..382 1772 90.7 Plus
Dper\GL24619-PA 407 GL24619-PA 63..391 39..369 889 48 Plus
Dper\GL23985-PA 533 GL23985-PA 5..331 5..321 233 25.5 Plus
Dper\GL20376-PA 482 GL20376-PA 40..293 41..275 228 25.1 Plus
Dper\GL17570-PA 434 GL17570-PA 39..368 39..341 216 23.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12541-PA 387 GA12541-PA 23..387 18..382 1902 96.7 Plus
Dpse\GA19080-PA 407 GA19080-PA 63..391 39..369 890 48 Plus
Dpse\GA22039-PA 533 GA22039-PA 13..331 26..321 231 25.8 Plus
Dpse\y-PA 560 GA17665-PA 40..293 41..275 230 25.5 Plus
Dpse\GA22103-PA 434 GA22103-PA 39..368 39..341 216 23.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14481-PA 382 GM14481-PA 1..382 1..382 2026 98.7 Plus
Dsec\GM14127-PA 393 GM14127-PA 49..377 39..369 901 48.6 Plus
Dsec\GM25935-PA 530 GM25935-PA 52..329 65..318 248 29.1 Plus
Dsec\y-PA 426 GM19059-PA 31..284 41..275 235 25.5 Plus
Dsec\GM16007-PA 430 GM16007-PA 37..351 40..328 209 23.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13677-PA 382 GD13677-PA 1..382 1..382 2025 98.7 Plus
Dsim\GD13396-PA 393 GD13396-PA 49..377 39..369 901 48.6 Plus
Dsim\GD20497-PA 530 GD20497-PA 52..329 65..318 247 29.1 Plus
Dsim\y-PA 406 GD24705-PA 31..284 41..275 234 25.5 Plus
Dsim\GD11758-PA 432 GD11758-PA 39..353 40..328 208 23.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13424-PA 387 GJ13424-PA 9..387 5..382 1883 93.1 Plus
Dvir\GJ11945-PA 395 GJ11945-PA 51..379 39..369 850 47.7 Plus
Dvir\GJ14923-PA 455 GJ14923-PA 47..240 40..226 242 29.9 Plus
Dvir\y-PA 541 GJ15591-PA 33..286 41..275 219 27.1 Plus
Dvir\GJ10736-PA 531 GJ10736-PA 1..307 3..294 213 26.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12633-PA 384 GK12633-PA 1..384 1..382 1885 92.2 Plus
Dwil\GK12518-PA 399 GK12518-PA 55..385 39..371 893 47.8 Plus
Dwil\GK13672-PA 468 GK13672-PA 48..426 33..373 238 23 Plus
Dwil\GK13342-PA 538 GK13342-PA 54..331 65..318 222 27.7 Plus
Dwil\GK25268-PA 545 GK25268-PA 35..288 41..275 215 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20312-PA 382 GE20312-PA 1..382 1..382 2017 98.4 Plus
Dyak\GE21714-PA 393 GE21714-PA 50..377 40..369 903 48.8 Plus
Dyak\GE24438-PA 530 GE24438-PA 50..329 63..318 257 30 Plus
Dyak\y-PA 541 GE16608-PA 31..284 41..275 235 25.9 Plus
Dyak\GE14541-PA 463 GE14541-PA 37..249 20..226 227 26.8 Plus